KEGG   Medicago truncatula (barrel medic): MTR_8g105630Help
Entry
MTR_8g105630      CDS       T01716                                 

Definition
Glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MTR_8g105630
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MTR_8g105630
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MTR_8g105630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 198 aa AA seqDB search
MDTQLLTFWNFLSFFLLLIALYFFRRNSSSKMAENSSKSIYDFTVKDISGNDVSLSQYRG
KVLLVVNVASQCGLTQTNYKELNVLYQKYKDQDFEILAFPCNQFRGQEPGSSEEIQNVVC
TRFKAEFPVFDKVEVNGKNAEPLYKFLKDQKGGIFGDGIKWNFTKFLVNKEGKVVDRYAP
TTAPLKIEKDIEKLLRSS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacacacagttgttgactttctggaacttcttatcgttctttcttcttcttatagct
ttatacttcttccgcagaaactcatcttccaaaatggcagaaaattcatccaaatccatc
tacgatttcactgtcaaggatatcagtggaaatgatgtgagtctgagtcaatacagaggg
aaggttctgctggttgtcaatgttgcctcccaatgcggtttgacacaaacaaattacaaa
gagttgaatgttctgtaccagaagtacaaggatcaagactttgaaatcttggcatttcca
tgcaaccaatttcgtggacaggagccaggatctagtgaagaaattcaaaatgttgtttgc
acaaggttcaaagctgaattcccagtctttgataaggttgaagtcaatgggaagaatgca
gaaccactttacaagtttttgaaggatcagaaaggaggaatatttggagatggtatcaag
tggaacttcacaaagttcttagtaaacaaagaagggaaggttgtggatagatatgctcct
accaccgctcctctgaaaatcgagaaggacatcgagaagcttttacggtcttcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system