KEGG   Medicago truncatula (barrel medic): MTR_8g105630Help
Entry
MTR_8g105630      CDS       T01716                                 

Definition
Glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mtr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mtr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 198 aa AA seqDB search
MDTQLLTFWNFLSFFLLLIALYFFRRNSSSKMAENSSKSIYDFTVKDISGNDVSLSQYRG
KVLLVVNVASQCGLTQTNYKELNVLYQKYKDQDFEILAFPCNQFRGQEPGSSEEIQNVVC
TRFKAEFPVFDKVEVNGKNAEPLYKFLKDQKGGIFGDGIKWNFTKFLVNKEGKVVDRYAP
TTAPLKIEKDIEKLLRSS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacacacagttgttgactttctggaacttcttatcgttctttcttcttcttatagct
ttatacttcttccgcagaaactcatcttccaaaatggcagaaaattcatccaaatccatc
tacgatttcactgtcaaggatatcagtggaaatgatgtgagtctgagtcaatacagaggg
aaggttctgctggttgtcaatgttgcctcccaatgcggtttgacacaaacaaattacaaa
gagttgaatgttctgtaccagaagtacaaggatcaagactttgaaatcttggcatttcca
tgcaaccaatttcgtggacaggagccaggatctagtgaagaaattcaaaatgttgtttgc
acaaggttcaaagctgaattcccagtctttgataaggttgaagtcaatgggaagaatgca
gaaccactttacaagtttttgaaggatcagaaaggaggaatatttggagatggtatcaag
tggaacttcacaaagttcttagtaaacaaagaagggaaggttgtggatagatatgctcct
accaccgctcctctgaaaatcgagaaggacatcgagaagcttttacggtcttcttaa

DBGET integrated database retrieval system