KEGG   Microbacterium testaceum: MTES_0141Help
Entry
MTES_0141         CDS       T01423                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mts  Microbacterium testaceum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mts00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(135527..137221)
Genome map
AA seq 564 aa AA seqDB search
MRVWRAGVRAAGVRAAAVRAAAVAATAVLLIAGAVVPAASAATVPGWLSTKGSTIVTAAG
SAYTIKATAWFGMETSNCAPHGLWSISLDEGMDAIAAMGFNAIRLPFSNECLAAKSSNSI
NASVNPGLVSLSPLKLMDAVIARAKAHGLSVILDRHRPDSGAQSELWYTAQYSEKRWIDD
WKMLAARYKNESAVIGADLHNEPHGPACWNCGDASRDWRAAATRAGNAVLSVNPKLLIIV
EGVENQRDGSATWWGGGLKDVRSAPVTLSVKNRVVYSPHEYPATVHAQPWFSASNYPANL
EGIWDANWGYLVRENIAPVLLGEFGTKLETTSDQAWLKTLVAYLAKTKMSYAYWSFNPNS
GDTGGLVADDWRTWQTAKLTALRPILTPGAVPTPKPTSSPKPTSSPKPTTKPSSSPKPTS
SPKPTSSPQPTTKPSSSPKPTSSPKPTSSPKPTSTPRPPASASPKPAGITASWIPQSSWG
EGYVAEVEVTATGTVSRWQVSFEAPGTTDVSNAWGMSCSLAGSTVTCRGADWAAALTAGQ
TVRVGLQATATRAPSSPKLTVRAS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgtggcgtgcgggcgtgcgggcggcgggcgtgcgtgcggcggccgtgcgcgcg
gcggccgtcgccgcgacggcggtcctcctgatcgcgggagcggtcgtccccgcggcgagc
gccgcgacggtgcccggctggctgtcgacgaaggggtcgacgatcgtcacggccgcgggc
tccgcctacacgatcaaggcgacggcgtggttcgggatggagacctcgaactgcgccccg
cacggactctggtcgatctcgctcgacgagggaatggatgccatcgcggcgatgggcttt
aacgccatccggctgcccttctcgaacgagtgcctcgccgcgaagagctcgaactcgatc
aacgcgtcggtcaacccgggactcgtctccctctcgccgctgaagctgatggatgccgtc
atcgcgcgggccaaggcccacgggctctcggtcatcctcgaccggcatcggcccgactcc
ggagcgcagagcgagctctggtacaccgcgcagtacagcgagaagcgctggatcgacgac
tggaagatgctcgctgcccgctacaagaacgagtccgccgtgatcggcgccgacctgcac
aacgaaccccacggaccggcctgctggaactgcggcgatgcgtcgcgcgactggcgcgcg
gccgcgacccgggccggcaacgcggtgctgtcggtcaatccgaagctcctgatcatcgtc
gagggcgtcgagaaccagcgcgacggctccgccacgtggtggggcggcggtctcaaggac
gtccggtcggcaccggtcaccctgtcggtgaagaaccgcgtggtctactcgccccacgag
tacccggcgacggtgcacgcgcagccctggttctcggcgtcgaactaccccgcgaacctc
gaggggatctgggatgccaactggggatacctcgtgcgcgagaacatcgcccccgtgctc
ctgggcgagttcggcacgaaactcgagaccacgagcgaccaggcgtggctgaagaccctc
gtcgcgtacctcgcgaagacgaagatgagctacgcgtactggtcgttcaaccccaacagc
ggggacacgggcggcctcgtcgccgacgactggcgtacctggcagacggccaagctgacg
gcgctccggccgatcctcacgccgggcgcggtgcccacgccgaagccgacgtcgagtccg
aagcccacgtcgagtccgaagccgacgaccaagccctcgtcgagtccgaagccgacctcg
agtcccaagccgacgtcgagcccccagccgacgaccaagccctcgtcgagtcccaagccc
acctcgagtcccaagcccacctcgagccccaagccgacgtccacgccccggcccccggca
tccgcttctccgaagcccgccggcatcacggcgtcgtggatcccgcagagctcctggggc
gaggggtacgtcgccgaggtcgaggtgacagcgacggggacggtctcacgctggcaggtg
tcgttcgaggcgccgggcaccaccgacgtctcgaacgcgtgggggatgagctgcagtctc
gccggcagcacggtgacgtgtcggggcgcggactgggccgcggcgctgaccgccggacag
accgtccgcgtgggtctgcaagcgacggcgacgcgcgctccgtcgtcgccgaagctcacg
gtccgcgcgtcctga

DBGET integrated database retrieval system