KEGG   Microbacterium testaceum: MTES_0273Help
Entry
MTES_0273         CDS       T01423                                 

Gene name
argJ
Definition
N-acetylglutamate synthase
Orthology
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MTES_0273 (argJ)
   01230 Biosynthesis of amino acids
    MTES_0273 (argJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MTES_0273 (argJ)
Enzymes [BR:mts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     MTES_0273 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     MTES_0273 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(274190..275347)
Genome map
AA seq 385 aa AA seqDB search
MSVTAPAGFEAAGVAVGLKSTGARDVAVVVNRGPLKVGAAVFTSNRAKANPILWSEQVVK
DGVVEAIVLNSGGANCFTGSFGFQTTHQTAERAAELLGVGAGDVLVCSTGLIGTGDEVFR
AKVLAGVDQGIATLSSEGGEDASLAIMTTDSKPKRAVHVGDGWSIGAMAKGAGMLAPGLA
TMLVVVTTDVVLDSAEADAALRAATRVSFDRLDSDGCMSTNDQVTLMVSGASGIRVPADE
FTAALTAVCDDLAAQLQGDAEGSSHDITIEVVNAASEEDAVEVGRSIARNNLFKAAIFGN
DPNWGRVLAAIGTTDAAFDPYDVDVWMNGVRVCTAGGPDRPREDVDLTPRATDLIVDLRV
GDATATIRTNDLTHDYVHENSAYSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgaccgcccccgccggattcgaggcggccggagtcgccgtcggcctgaagtcg
acgggcgcgcgtgacgtcgccgtcgtggtcaaccgcggtcccctgaaggtgggcgccgcc
gtgttcacctccaaccgcgccaaggcgaacccgatcctgtggtcggagcaggtcgtgaag
gacggggtcgtcgaggcgatcgtgctcaactccggcggcgcgaactgcttcaccggctcg
ttcggattccagaccacgcaccagaccgccgagcgcgcggccgagctgctcggcgtcggc
gccggtgacgttctcgtgtgctcgacgggactcatcggcacgggggacgaggtcttccgg
gcgaaggtgctcgcgggagtcgaccaggggatcgcgacgctgtcgtccgagggcggcgag
gacgcgtcgctcgcgatcatgaccaccgactcgaagcccaagcgcgccgtgcacgtcgga
gacggctggtcgatcggtgcgatggcgaagggcgccggcatgctggctccgggcctcgcg
accatgctcgtcgtcgtcacgaccgacgtcgtcctcgactcggccgaggcggacgccgcc
ctccgtgccgcgacgcgcgtcagcttcgaccgcctcgattccgacggctgcatgtcgacc
aacgaccaggtcacgctgatggtgagtggggccagtggcatccgggttcccgccgacgag
ttcacggcggcgctgaccgcggtgtgcgacgatctcgccgctcagctgcagggggatgcc
gagggttccagccacgacatcaccatcgaggtcgtgaacgccgccagcgaggaggacgcc
gtcgaggtggggcgctcgatcgcccgcaacaacctcttcaaggccgcgatcttcggcaac
gacccgaactgggggcgcgtgctcgccgcgatcggcacgaccgacgccgccttcgacccg
tacgacgtggatgtgtggatgaacggcgtgcgcgtgtgcaccgccgggggtcccgaccgt
ccccgcgaggacgtcgacctcaccccgcgcgcgaccgacctcatcgtcgatctgcgggtc
ggcgacgcgacggccacgatccgcaccaacgacctcacgcacgattacgtccacgagaac
agcgcctactcctcatga

DBGET integrated database retrieval system