KEGG   Microbacterium testaceum: MTES_0273Help
Entry
MTES_0273         CDS       T01423                                 

Gene name
argJ
Definition
(GenBank) N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00220  Arginine biosynthesis
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01130  Biosynthesis of antibiotics
mts01210  2-Oxocarboxylic acid metabolism
mts01230  Biosynthesis of amino acids
Module
mts_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MTES_0273 (argJ)
Enzymes [BR:mts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     MTES_0273 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     MTES_0273 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: BAJ73237
UniProt: E8N9J0
Position
complement(274190..275347)
Genome map
AA seq 385 aa AA seqDB search
MSVTAPAGFEAAGVAVGLKSTGARDVAVVVNRGPLKVGAAVFTSNRAKANPILWSEQVVK
DGVVEAIVLNSGGANCFTGSFGFQTTHQTAERAAELLGVGAGDVLVCSTGLIGTGDEVFR
AKVLAGVDQGIATLSSEGGEDASLAIMTTDSKPKRAVHVGDGWSIGAMAKGAGMLAPGLA
TMLVVVTTDVVLDSAEADAALRAATRVSFDRLDSDGCMSTNDQVTLMVSGASGIRVPADE
FTAALTAVCDDLAAQLQGDAEGSSHDITIEVVNAASEEDAVEVGRSIARNNLFKAAIFGN
DPNWGRVLAAIGTTDAAFDPYDVDVWMNGVRVCTAGGPDRPREDVDLTPRATDLIVDLRV
GDATATIRTNDLTHDYVHENSAYSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgaccgcccccgccggattcgaggcggccggagtcgccgtcggcctgaagtcg
acgggcgcgcgtgacgtcgccgtcgtggtcaaccgcggtcccctgaaggtgggcgccgcc
gtgttcacctccaaccgcgccaaggcgaacccgatcctgtggtcggagcaggtcgtgaag
gacggggtcgtcgaggcgatcgtgctcaactccggcggcgcgaactgcttcaccggctcg
ttcggattccagaccacgcaccagaccgccgagcgcgcggccgagctgctcggcgtcggc
gccggtgacgttctcgtgtgctcgacgggactcatcggcacgggggacgaggtcttccgg
gcgaaggtgctcgcgggagtcgaccaggggatcgcgacgctgtcgtccgagggcggcgag
gacgcgtcgctcgcgatcatgaccaccgactcgaagcccaagcgcgccgtgcacgtcgga
gacggctggtcgatcggtgcgatggcgaagggcgccggcatgctggctccgggcctcgcg
accatgctcgtcgtcgtcacgaccgacgtcgtcctcgactcggccgaggcggacgccgcc
ctccgtgccgcgacgcgcgtcagcttcgaccgcctcgattccgacggctgcatgtcgacc
aacgaccaggtcacgctgatggtgagtggggccagtggcatccgggttcccgccgacgag
ttcacggcggcgctgaccgcggtgtgcgacgatctcgccgctcagctgcagggggatgcc
gagggttccagccacgacatcaccatcgaggtcgtgaacgccgccagcgaggaggacgcc
gtcgaggtggggcgctcgatcgcccgcaacaacctcttcaaggccgcgatcttcggcaac
gacccgaactgggggcgcgtgctcgccgcgatcggcacgaccgacgccgccttcgacccg
tacgacgtggatgtgtggatgaacggcgtgcgcgtgtgcaccgccgggggtcccgaccgt
ccccgcgaggacgtcgacctcaccccgcgcgcgaccgacctcatcgtcgatctgcgggtc
ggcgacgcgacggccacgatccgcaccaacgacctcacgcacgattacgtccacgagaac
agcgcctactcctcatga

DBGET integrated database retrieval system