KEGG   Microbacterium testaceum: MTES_0316Help
Entry
MTES_0316         CDS       T01423                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mts  Microbacterium testaceum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mts00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mts00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(316467..316967)
Genome map
AA seq 166 aa AA seqDB search
MTEIGLVWAEARGGVIGSDGGMPWHVPEDLAHFRAVTGSSDVVMGRRTWESLPPRFRPLP
GRRNIVVTGTDTWSAEGAERATSFDDALSRAESDTVWVIGGGRLYADAIHRADVVELTRL
DVAVEGDTFAPSIEGWRRDAVDPAEEWHTSRTGIRYRFETYRRRED
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgggctcgtctgggccgaagcccgcggaggcgtcatcggctccgacggc
ggcatgccctggcacgtacccgaagacctcgcgcacttccgcgctgtgaccgggtcgtcc
gacgtcgtcatgggccggaggacgtgggagtcgcttccgccgaggttccggcccctgccc
ggccgtcgcaacatcgtggtcaccggcaccgatacgtggagcgcggagggcgccgagagg
gcgacctcgttcgacgacgccctctcccgcgcggagagcgacacggtgtgggtcatcggc
ggcggtcgcctctacgccgacgcgatccaccgtgccgacgtcgtcgagctcacgcgtctc
gacgtggccgtcgaaggcgacaccttcgccccctcgatcgaggggtggcggcgggacgcc
gtcgacccggcggaggaatggcacacgtcgaggaccggcatccggtatcgcttcgagacc
tatcgccgccgggaggactga

DBGET integrated database retrieval system