KEGG   Microbacterium testaceum: MTES_0357Help
Entry
MTES_0357         CDS       T01423                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_0357 (pfkA)
   01230 Biosynthesis of amino acids
    MTES_0357 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_0357 (pfkA)
   00030 Pentose phosphate pathway
    MTES_0357 (pfkA)
   00051 Fructose and mannose metabolism
    MTES_0357 (pfkA)
   00052 Galactose metabolism
    MTES_0357 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MTES_0357 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MTES_0357 (pfkA)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MTES_0357 (pfkA)
Protein phosphatases and associated proteins [BR:mts01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MTES_0357 (pfkA)
Messenger RNA biogenesis [BR:mts03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MTES_0357 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(360358..361386)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGVVLKGTTNYDIEFVGIRDGWRGVVDGDFFPLTRHEVKGL
SKVGGTILGTSRTNPYEGVRGGAENISKTLYGHRIDGILAIGGEGTLAAADRLSKDGINV
LGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
AGIAAGAHVICIPEVPMSIDEIVEQVTRAHDRGRAPLVVVSEGFKLTGMDEAFSDKGLDA
FNRPRLGGIGELLAPEIERLTGIETRSTVLGHIQRGGSPSAFDRVLATRLGLHAADALHE
GAWGQMVAMRGTDIVRVPFADALGELNSVPLYRYEEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcctgaccagcggcggcgactgccccggtctcaacgcggtcatccgt
ggcgtcgtgctgaagggcacgaccaactacgacatcgagttcgtcggcatccgtgacgga
tggcgcggcgtggtcgacggcgacttcttccccctcacgcgccacgaggtgaaggggctg
tcgaaggtcggcggcaccatcctcggcacgagccggaccaacccctacgagggcgtgcgc
ggcggcgccgagaacatctcgaagacgctctacgggcaccggatcgacggcatcctggcc
atcggcggcgagggtaccctcgccgcggccgaccgtctgtcgaaggacggcatcaacgtc
ctcggcgtgccgaagacgatcgacaacgacctgcgcgccaccgactactcgttcggattc
gacaccgccgtcaacatcgcgacggatgccatggaccgcctccgcacgaccggcgactcg
caccagcgctgcatggtcgccgaggtcatggggcgccacgtcggctggatcgcgctccac
gccgggatcgccgcgggcgcccacgtcatctgcatccccgaggtgccgatgtcgatcgat
gagatcgtcgagcaggtcacccgcgcccacgaccgcggtcgcgcgcctctggtcgtcgtg
tccgagggcttcaagctcaccggcatggacgaggccttcagcgacaagggcctggatgcc
ttcaaccgtccccgcctcggcggcatcggcgagctcctcgcccccgagatcgagcgcctc
accggcatcgagacccgctcgacggtcctcggccacatccagcgcggcggctcgccgtcg
gcgttcgaccgcgtcctcgcgacgcgcctcggcctccacgccgccgacgccctgcacgag
ggagcctgggggcagatggtcgcgatgcgcggcaccgacatcgtgcgcgtccccttcgcc
gacgcgctcggcgagctcaacagcgtgccgctgtaccgctacgaggaggccgccgccctg
ttcggctga

DBGET integrated database retrieval system