KEGG   Microbacterium testaceum: MTES_0390Help
Entry
MTES_0390         CDS       T01423                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mts  Microbacterium testaceum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MTES_0390
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MTES_0390
Enzymes [BR:mts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MTES_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399865..401523
Genome map
AA seq 552 aa AA seqDB search
MPTDATPNLPPVLRPERPPQRDLAELARRFGVRSVGEVEGTTLTGITLATADLRAGEAFV
AIRGVNRHGAEFAATAAERGAVAVITDAEGAEIAASTGLPIVIVEDPRALLGDLSAWVYG
TGPDDDIPQLLATTGTNGKTSVSHLLEGILGQLGVVTGLSSTAERHIAGEVIVSRLTTPE
ASEFHALLALMRERGVEAVAVEVSAQALTRHRVDGLVFDVAGFTNLTHDHLDDYADMREY
FEAKLPLFRADRARRGVVCLDSASGAEIVARAEIPVVTIVTPAIAEDPSADADWTVDIVD
ERQEGTEFTLRARDGRALTTVVPVIGRHMAANAGLAIVMLLETGYAWERLVDALDGGRID
ASLPGRTQLVSGPEGPAVYVDFGHSPDAFEKTLAAVRRVTPGKVVMLFGADGDRDATKRH
DMGRTAVLGSDILVVTDHHPRHEDPDAIRAVLVEGARRARPDAEILEFTPPERAILEAVK
LVGEGDAILWAGPGHQDYRDIRGVRTPYSARELSRRALRAAGWAVPEPQWPVPYPDDSTP
SSDPERPVDFPA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgacgccaccccgaacctcccgcccgtgctccggcccgagcgtccgccccag
cgcgacctcgccgagctcgcccgccgattcggcgtccgcagcgtcggggaggtcgagggc
acgaccctcacgggcatcacgctcgcgaccgccgacctccgcgcgggagaggctttcgtc
gcgatccgcggcgtgaaccgacacggggcggagttcgccgcgacggccgccgaacgcggg
gccgtcgccgtcatcaccgacgccgagggcgccgagatcgcggcatccacgggtcttccg
atcgtgatcgtggaggatccgcgcgcgcttctgggcgacctgtccgcgtgggtgtacggc
accggcccggacgacgacatccctcagctgctggccacgaccggcacgaacggcaagacg
agcgtgtcgcacctgctcgaggggatcctcgggcagctgggcgtcgtcacgggcctgtcg
tcgacggcggagcgccacatcgccggagaggtcatcgtctcgcggctcaccacccccgag
gcatccgagttccacgcccttctcgcgctcatgcgcgaacgcggggtcgaggccgtggcg
gtcgaggtgagcgcgcaggcgctcacccgtcaccgcgtcgacggtctcgtcttcgacgtg
gccggcttcaccaacctcacccacgaccacctcgacgactacgccgacatgcgcgagtac
ttcgaggcgaagctccccctcttccgtgccgaccgcgcgcgccgcggggtcgtgtgcctc
gactcggcgtcgggtgccgagatcgtggcccgcgccgagatccccgtggtcacgatcgtc
acccccgcgatcgccgaggacccctccgccgacgccgactggacggtcgacatcgtcgac
gagcgccaggagggcaccgagttcaccctgcgcgcgcgcgacggtcgggctctcaccacc
gtcgtcccggtgatcggtcggcacatggccgccaacgccggcctcgcgatcgtgatgctg
ctcgagaccggatacgcgtgggaacgcctcgtcgacgccctcgacggcggccgcatcgac
gcctccctcccggggcgcacgcagctcgtctccggccccgagggcccggcggtctacgtc
gacttcggccactcccccgacgcgttcgagaagaccctggccgccgttcgacgcgtgacc
cccggcaaggtcgtcatgctcttcggggccgacggcgaccgcgacgccaccaagcgccac
gacatgggacgcaccgccgtcctcggcagcgacatcctcgtcgtgaccgaccaccacccc
cgccacgaggatccggatgccatccgcgcggtgctcgtcgagggcgcacgccgtgcacgg
cccgacgccgagatcctcgagttcactccgcccgagcgcgcgatcctcgaggccgtgaag
ctcgtcggcgagggcgacgcgatcctctgggccgggcccgggcaccaggactaccgtgac
atccgcggggtgcgcacgccctactccgcgcgcgagctgtcccggcgggcgctgcgcgcg
gcggggtgggccgtgcccgagccgcagtggcccgtgccgtacccggacgacagcacgccg
tcgtccgaccccgagcgcccggtggacttccccgcctga

DBGET integrated database retrieval system