KEGG   Microbacterium testaceum: MTES_0401Help
Entry
MTES_0401         CDS       T01423                                 

Gene name
glpk
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mts  Microbacterium testaceum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MTES_0401 (glpk)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MTES_0401 (glpk)
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTES_0401 (glpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411539..413050
Genome map
AA seq 503 aa AA seqDB search
MADYVLAIDQGTTSTRAMIFDKSGGVVAVGQKEHEQIFPRAGWVEHDPLEIWRNTQEVIG
LALSRADITRHDIAAVGITNQRETAVVWDKNTGKPVYNAIVWQDTRTQSIVDRLADGDTE
RYKSIVGLPLATYFSGTKIVWILENVDGAREKAEAGDLIFGTTDTWVLWNLTGGIDGGVH
ATDVTNASRTLFMDLETLEWRDDILADFGVPRSMMPEIRSSSEVYGTVESSSLLRETPVA
GILGDQQAATFGQAAFDPGESKNTYGTGNFLIFQTGEEIVHSKNGLLTTLGYKLGDQPAR
YALEGSIAVTGSLIQWLRDQLGIISSAPEVETLASSVDDNGGVYFVPAFSGLFAPYWRPD
ARGAIVGMTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTELKVDGGMTANDALM
QFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWDNLDDLRANWQEDKRWEPDMDSDER
DRELRLWKKAVTKSMDWVDEDVR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccgactacgtcctcgccatcgaccagggcacgacctcgacgcgcgcgatgatcttc
gacaagtccggaggcgtcgtcgccgtcgggcagaaggagcacgagcagatcttcccccgc
gcggggtgggtcgagcacgacccgctcgagatctggcgcaacacccaggaggtgatcggc
ctcgccctgagccgcgccgacatcacccgtcacgacatcgccgccgtcggcatcaccaac
cagcgcgagaccgccgtcgtctgggacaagaacaccggaaagcccgtctacaacgccatc
gtgtggcaggacacgcgcacgcagtcgatcgtcgaccgcctcgccgacggcgacaccgag
cgctacaagagcatcgtcggtctcccgctggcgacgtacttctccggcacgaagatcgtc
tggatcctcgagaacgtcgacggcgcccgcgagaaggcggaagccggcgacctgatcttc
ggcaccaccgacacctgggtgctgtggaacctcaccggcggcatcgacggcggcgtgcac
gcgaccgacgtcacgaatgccagccgcacgctcttcatggacctcgagaccctcgagtgg
cgcgacgacatcctcgccgacttcggcgtcccgcgttcgatgatgcccgagatccgttcg
tcctccgaggtctacggcaccgtcgagtcgtcgtcgctcctgcgcgagacccccgtggcc
ggcatcctgggcgaccagcaggcggcgaccttcggtcaggccgccttcgacccgggtgag
agcaagaacacctacggcacgggtaacttcctcatcttccagacgggcgaggagatcgtc
cactcgaagaacggcctgctgacgaccctcggctacaagctcggcgaccagcccgcccgg
tacgcgctcgagggctcgatcgcggtgaccggttcgctcatccagtggctgcgcgaccag
ctcggcatcatctcctcggcccccgaggtggagaccctggcgagctccgtcgacgacaac
ggtggcgtgtacttcgtgccggcgttctcgggcctgttcgcgccctactggcgtcccgac
gcccgtggtgcgatcgtcggcatgacccggtacgtcaacaagggacacatcgcccgcgct
gctctcgaggcgaccgccttccagacccgcgaggtgctcgacgcggtcaacgccgactcg
ggcgtcgacctcaccgagctcaaggtcgacggcggcatgaccgccaacgacgctctgatg
cagttccaggccgacatcctcggcgtcccagtggtgcgcccggtcgtcgccgagaccacc
gccctcggtgccgcctacgccgccggtctcgccgtcggtttctgggacaacctcgacgac
ctccgcgccaactggcaggaggacaagcgctgggagcccgacatggactccgacgagcgc
gaccgcgagctgcgcctctggaagaaggccgtcaccaagtccatggactgggtcgacgaa
gacgtgcgctga

DBGET integrated database retrieval system