KEGG   Microbacterium testaceum: MTES_0428Help
Entry
MTES_0428         CDS       T01423                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00260  Glycine, serine and threonine metabolism
mts00750  Vitamin B6 metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01230  Biosynthesis of amino acids
Module
mts_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_0428 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTES_0428 (thrC)
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTES_0428 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: BAJ73392
UniProt: E8NAX0
Position
complement(438433..439515)
Genome map
AA seq 360 aa AA seqDB search
MAHLWGGVLREYADRLGVTDASTVVTLGEGGTPLLPAPALSRRTGADVWVKYEGMNPTGS
FKDRGMTVALSRAVEHGAKAVICASTGNTSASAAAYAAHAGITAAVLVPEGKIAMGKLSQ
AVAHNGRLIQIRGNFDDCLEIARELADHYPVHLVNSVNPDRIEGQKTAAYEVVEVLGDAP
DFHFIPVGNAGNYTAYSRGYREEAARGVATRVPRMFGFQAAGSAPLVRGEVVKNPETIAS
AIRIGNPASWELALEARDATDGYFGAIDDARILEAQKILAGEVGIFVEPASAISVAGLLE
RAEAGVVPAGAKVVLTVTGHGLKDPQWALRQSDGTDVTPTVVDATTSEVASVLDLQPVTA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctctggggcggagtcctccgcgaatacgccgaccggctgggcgtcaccgac
gcctccaccgtcgtcaccctcggcgagggcggcacgccgctcctgcccgctcccgcgctc
tcgcgccggaccggtgccgatgtgtgggtgaagtacgagggcatgaacccgaccggttcg
ttcaaggaccgcggtatgaccgtcgcgctctcccgtgccgtcgagcacggggccaaggcc
gtcatctgcgcctcgaccggcaacacctcggcctcggcggcggcctacgccgcccacgcc
gggatcaccgccgcggtgctcgtgcccgagggcaagatcgcgatgggcaagctcagccag
gccgtcgcccacaacgggcgcctgatccagatccgcggcaacttcgacgactgcctcgag
atcgcacgcgagctcgccgaccactacccggtccacctcgtcaactcggtgaaccccgac
cgcatcgaggggcagaagacggcggcctacgaggtcgtcgaggtcctgggcgacgccccc
gacttccacttcatccccgtcggcaacgccggaaactacaccgcgtactcgcgcggctac
cgcgaagaggccgcccgcggcgtcgccacgcgcgttccccggatgttcggcttccaggcc
gccggttccgccccgctcgtgcgcggcgaggtcgtgaagaaccccgagacgatcgccagc
gcgatccgcatcggcaaccccgcctcgtgggagctcgcgctcgaagcgcgcgacgccacg
gacggctacttcggcgcgatcgacgacgcccgcatcctcgaggcgcagaagatcctcgcc
ggcgaggtcgggatcttcgtcgagcccgcctcggcgatcagcgtcgcgggcctgctcgag
cgggccgaggccggggtcgtccccgccggcgccaaggtcgtgctgaccgtcaccggccac
ggcctgaaggacccccagtgggccctccgccagtccgacggcaccgacgtcacccccacc
gtcgtcgacgcgaccacgtccgaggtcgcatcggtgctcgacctgcagccggtgaccgcg
tga

DBGET integrated database retrieval system