KEGG   Microbacterium testaceum: MTES_0428Help
Entry
MTES_0428         CDS       T01423                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mts  Microbacterium testaceum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_0428 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_0428 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTES_0428 (thrC)
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTES_0428 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(438433..439515)
Genome map
AA seq 360 aa AA seqDB search
MAHLWGGVLREYADRLGVTDASTVVTLGEGGTPLLPAPALSRRTGADVWVKYEGMNPTGS
FKDRGMTVALSRAVEHGAKAVICASTGNTSASAAAYAAHAGITAAVLVPEGKIAMGKLSQ
AVAHNGRLIQIRGNFDDCLEIARELADHYPVHLVNSVNPDRIEGQKTAAYEVVEVLGDAP
DFHFIPVGNAGNYTAYSRGYREEAARGVATRVPRMFGFQAAGSAPLVRGEVVKNPETIAS
AIRIGNPASWELALEARDATDGYFGAIDDARILEAQKILAGEVGIFVEPASAISVAGLLE
RAEAGVVPAGAKVVLTVTGHGLKDPQWALRQSDGTDVTPTVVDATTSEVASVLDLQPVTA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctctggggcggagtcctccgcgaatacgccgaccggctgggcgtcaccgac
gcctccaccgtcgtcaccctcggcgagggcggcacgccgctcctgcccgctcccgcgctc
tcgcgccggaccggtgccgatgtgtgggtgaagtacgagggcatgaacccgaccggttcg
ttcaaggaccgcggtatgaccgtcgcgctctcccgtgccgtcgagcacggggccaaggcc
gtcatctgcgcctcgaccggcaacacctcggcctcggcggcggcctacgccgcccacgcc
gggatcaccgccgcggtgctcgtgcccgagggcaagatcgcgatgggcaagctcagccag
gccgtcgcccacaacgggcgcctgatccagatccgcggcaacttcgacgactgcctcgag
atcgcacgcgagctcgccgaccactacccggtccacctcgtcaactcggtgaaccccgac
cgcatcgaggggcagaagacggcggcctacgaggtcgtcgaggtcctgggcgacgccccc
gacttccacttcatccccgtcggcaacgccggaaactacaccgcgtactcgcgcggctac
cgcgaagaggccgcccgcggcgtcgccacgcgcgttccccggatgttcggcttccaggcc
gccggttccgccccgctcgtgcgcggcgaggtcgtgaagaaccccgagacgatcgccagc
gcgatccgcatcggcaaccccgcctcgtgggagctcgcgctcgaagcgcgcgacgccacg
gacggctacttcggcgcgatcgacgacgcccgcatcctcgaggcgcagaagatcctcgcc
ggcgaggtcgggatcttcgtcgagcccgcctcggcgatcagcgtcgcgggcctgctcgag
cgggccgaggccggggtcgtccccgccggcgccaaggtcgtgctgaccgtcaccggccac
ggcctgaaggacccccagtgggccctccgccagtccgacggcaccgacgtcacccccacc
gtcgtcgacgcgaccacgtccgaggtcgcatcggtgctcgacctgcagccggtgaccgcg
tga

DBGET integrated database retrieval system