KEGG   Microbacterium testaceum: MTES_0465Help
Entry
MTES_0465         CDS       T01423                                 

Definition
(GenBank) arginase/agmatinase/formimionoglutamate hydrolase, arginase family
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00220  Arginine biosynthesis
mts00330  Arginine and proline metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01130  Biosynthesis of antibiotics
mts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MTES_0465
   00330 Arginine and proline metabolism
    MTES_0465
Enzymes [BR:mts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MTES_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAJ73429
UniProt: E8NB07
Position
480551..481363
Genome map
AA seq 270 aa AA seqDB search
MARFIVAPQWQGSSSSRAMQLIDGAEAIAGDLPRASTTVLDAVPEAGDAQGTGVHRLSAL
MRMRERIEDAVRAGDEPAIVIGGDCGVALGSVSAVAGDDLAVVWIDAHADLNTPASSPSG
AFHGMVLRAIAGEGDDLHRLEPGITPGRIVLAGTRALDAEEQRFIEHHGVRVIAPDDLAD
PDVLAEAVVATGASRVYVHVDLDVLDPAEMTGVALPEPFGARTADVVASIRRLRERLPLA
GATLTEFSPSSPAAAVDDLGTILRLIGALA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttcatcgtcgctccgcagtggcagggctcgtcctcgtcgcgcgcgatgcag
ctcatcgacggtgccgaggcgatcgcgggcgacctgccgcgcgcctcgaccaccgtcctc
gacgcggtgcccgaagccggagacgcgcagggaacgggcgtgcatcgcctcagtgccctg
atgcggatgcgcgagcggatcgaggacgccgtgcgcgccggtgacgagcccgcgatcgtc
atcgggggcgactgcggcgtggccctcggctccgtctccgccgtcgcgggcgacgacctc
gccgtggtgtggatcgacgcccacgccgacctcaacaccccggcctcctcccccagcggc
gcgttccacggcatggtcctgcgcgcgatcgcgggagagggcgacgacctccaccgcctc
gaacccgggatcacccccggacgaatcgtgctcgccgggactcgagccctggatgccgag
gagcagcgcttcatcgagcatcacggcgtgcgggtcatcgcccccgatgacctggccgat
cccgacgtgctggccgaggcggtcgtggcgacgggagcatcccgcgtctacgtgcacgtc
gacctcgacgtgctcgacccggcggagatgacaggcgtcgcccttcccgaaccgttcggt
gcgcgcacggccgacgtcgtggcatccatccgtcgcctgcgcgagcgcctgccgctcgcg
ggggcgacgctcaccgagttctctccgtcgtctcccgccgcggccgtcgatgacctcgga
acgatcctgcgcctgatcggggccctggcgtga

DBGET integrated database retrieval system