KEGG   Microbacterium testaceum: MTES_0465Help
Entry
MTES_0465         CDS       T01423                                 

Definition
arginase/agmatinase/formimionoglutamate hydrolase, arginase family
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mts  Microbacterium testaceum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_0465
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MTES_0465
Enzymes [BR:mts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MTES_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480551..481363
Genome map
AA seq 270 aa AA seqDB search
MARFIVAPQWQGSSSSRAMQLIDGAEAIAGDLPRASTTVLDAVPEAGDAQGTGVHRLSAL
MRMRERIEDAVRAGDEPAIVIGGDCGVALGSVSAVAGDDLAVVWIDAHADLNTPASSPSG
AFHGMVLRAIAGEGDDLHRLEPGITPGRIVLAGTRALDAEEQRFIEHHGVRVIAPDDLAD
PDVLAEAVVATGASRVYVHVDLDVLDPAEMTGVALPEPFGARTADVVASIRRLRERLPLA
GATLTEFSPSSPAAAVDDLGTILRLIGALA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttcatcgtcgctccgcagtggcagggctcgtcctcgtcgcgcgcgatgcag
ctcatcgacggtgccgaggcgatcgcgggcgacctgccgcgcgcctcgaccaccgtcctc
gacgcggtgcccgaagccggagacgcgcagggaacgggcgtgcatcgcctcagtgccctg
atgcggatgcgcgagcggatcgaggacgccgtgcgcgccggtgacgagcccgcgatcgtc
atcgggggcgactgcggcgtggccctcggctccgtctccgccgtcgcgggcgacgacctc
gccgtggtgtggatcgacgcccacgccgacctcaacaccccggcctcctcccccagcggc
gcgttccacggcatggtcctgcgcgcgatcgcgggagagggcgacgacctccaccgcctc
gaacccgggatcacccccggacgaatcgtgctcgccgggactcgagccctggatgccgag
gagcagcgcttcatcgagcatcacggcgtgcgggtcatcgcccccgatgacctggccgat
cccgacgtgctggccgaggcggtcgtggcgacgggagcatcccgcgtctacgtgcacgtc
gacctcgacgtgctcgacccggcggagatgacaggcgtcgcccttcccgaaccgttcggt
gcgcgcacggccgacgtcgtggcatccatccgtcgcctgcgcgagcgcctgccgctcgcg
ggggcgacgctcaccgagttctctccgtcgtctcccgccgcggccgtcgatgacctcgga
acgatcctgcgcctgatcggggccctggcgtga

DBGET integrated database retrieval system