KEGG   Microbacterium testaceum: MTES_0617Help
Entry
MTES_0617         CDS       T01423                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mts  Microbacterium testaceum
Pathway
mts00240  Pyrimidine metabolism
mts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MTES_0617 (deoA)
Enzymes [BR:mts01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MTES_0617 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254 Biotin_lipoyl_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: BAJ73581
UniProt: E8NCD3
Position
complement(657839..659173)
Genome map
AA seq 444 aa AA seqDB search
MTLRQAQGPHRQAQGPVPEAYDAVDIIRAQRDGRAITEGEIRWLVDAYTRGYVMDAQMSA
FTMAVLLNGLGRDQIRVLTDAMIASGERMDFSSLGKVTVDKHSTGGVGDKITLPLAPLVA
AFGVAVPQLSGRGLGHTGGTLDKLESIPGWRAALSNDEIMAQLRDVGAVICAAGTGLAPA
DKKLYALRDVTGTVEAIPLIASSIMSKKIAEGTDSLVLDVKFGSGAFMQDIDRARELAET
MVALGTDSGVNTTALLTDMNTPLGLAIGNANEVRESVEVLAGGGPADVVELTVALAREML
TLAGQPDADVEAALTDGRAMDVWKRMIRAQDGDPDAALPTPRETHTVVAERSGVVTRVEA
LPFGIGAWRLGAGRARAEDAVVHAAGIDLHVTVGQSVTAGQPLFTLSADEESRFERALGA
VEGALEIGDTAPAASPLVRERITA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgacaggctcagggaccccatcgacaggctcagggaccggtgccagaggct
tacgacgcggtcgacatcatccgcgctcagcgcgacgggcgtgccatcaccgagggcgag
atccggtggttggtcgacgcgtacacgcgcggctacgtcatggacgcgcagatgtcggcg
ttcaccatggcggtcctgctgaacggcctcggccgcgaccagatccgcgtgctcaccgac
gccatgatcgcctcgggcgagcgcatggacttctcctccctcggcaaggtcaccgtcgac
aagcactcgacgggtggcgtgggcgacaagatcaccctcccgctggctccgctggtcgcc
gcgttcggcgtcgccgtgccgcagttgtcgggccgcggcctcggccacaccggtggcacg
ctcgacaagctcgagtcgatccccggctggcgcgcggcgctgtcgaacgacgagatcatg
gcgcagctgcgcgacgtgggcgcggtcatctgcgccgccggcaccggtctcgccccggcc
gacaagaagctctacgcgctccgcgacgtcaccggcacggtcgaggcgatcccgctcatc
gcgtcgagcatcatgtcgaagaagatcgccgagggcaccgactcgctcgtgctcgacgtg
aagttcggctccggcgccttcatgcaggacatcgatcgcgcgcgcgagctcgccgagacg
atggtcgcgctcggcacggactcgggcgtgaacaccaccgcgctgctcaccgacatgaac
accccgctcggcctcgcgatcggcaacgccaacgaggtgcgcgaatccgtcgaggtactc
gccggtggcggccccgccgacgtcgtggagctcacggtcgcgctcgcccgcgagatgctc
acgctcgccggtcagccggatgccgacgtcgaggccgccctcacggacggccgcgcgatg
gacgtgtggaagcgcatgatccgcgcacaggacggagatccggatgccgccctccccacg
ccgcgcgagacccacacggtcgtcgccgagcgttcgggggtcgtgacgcgcgtcgaggct
ctgccgttcggcatcggcgcgtggcgtctgggcgccggccgcgcacgggccgaggacgcc
gtcgtgcacgccgcgggcatcgacctgcacgtcacggtcggccagtcggtcacggccggt
cagccgctgttcaccctgtcggccgatgaggagtcgcgcttcgagcgcgctctcggcgcc
gtcgagggcgcgctggagatcggcgacacggcccccgccgcctcgccgctcgtgcgcgag
cggatcaccgcgtga

DBGET integrated database retrieval system