KEGG   Microbacterium testaceum: MTES_0617Help
Entry
MTES_0617         CDS       T01423                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mts  Microbacterium testaceum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mts00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657839..659173)
Genome map
AA seq 444 aa AA seqDB search
MTLRQAQGPHRQAQGPVPEAYDAVDIIRAQRDGRAITEGEIRWLVDAYTRGYVMDAQMSA
FTMAVLLNGLGRDQIRVLTDAMIASGERMDFSSLGKVTVDKHSTGGVGDKITLPLAPLVA
AFGVAVPQLSGRGLGHTGGTLDKLESIPGWRAALSNDEIMAQLRDVGAVICAAGTGLAPA
DKKLYALRDVTGTVEAIPLIASSIMSKKIAEGTDSLVLDVKFGSGAFMQDIDRARELAET
MVALGTDSGVNTTALLTDMNTPLGLAIGNANEVRESVEVLAGGGPADVVELTVALAREML
TLAGQPDADVEAALTDGRAMDVWKRMIRAQDGDPDAALPTPRETHTVVAERSGVVTRVEA
LPFGIGAWRLGAGRARAEDAVVHAAGIDLHVTVGQSVTAGQPLFTLSADEESRFERALGA
VEGALEIGDTAPAASPLVRERITA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgacaggctcagggaccccatcgacaggctcagggaccggtgccagaggct
tacgacgcggtcgacatcatccgcgctcagcgcgacgggcgtgccatcaccgagggcgag
atccggtggttggtcgacgcgtacacgcgcggctacgtcatggacgcgcagatgtcggcg
ttcaccatggcggtcctgctgaacggcctcggccgcgaccagatccgcgtgctcaccgac
gccatgatcgcctcgggcgagcgcatggacttctcctccctcggcaaggtcaccgtcgac
aagcactcgacgggtggcgtgggcgacaagatcaccctcccgctggctccgctggtcgcc
gcgttcggcgtcgccgtgccgcagttgtcgggccgcggcctcggccacaccggtggcacg
ctcgacaagctcgagtcgatccccggctggcgcgcggcgctgtcgaacgacgagatcatg
gcgcagctgcgcgacgtgggcgcggtcatctgcgccgccggcaccggtctcgccccggcc
gacaagaagctctacgcgctccgcgacgtcaccggcacggtcgaggcgatcccgctcatc
gcgtcgagcatcatgtcgaagaagatcgccgagggcaccgactcgctcgtgctcgacgtg
aagttcggctccggcgccttcatgcaggacatcgatcgcgcgcgcgagctcgccgagacg
atggtcgcgctcggcacggactcgggcgtgaacaccaccgcgctgctcaccgacatgaac
accccgctcggcctcgcgatcggcaacgccaacgaggtgcgcgaatccgtcgaggtactc
gccggtggcggccccgccgacgtcgtggagctcacggtcgcgctcgcccgcgagatgctc
acgctcgccggtcagccggatgccgacgtcgaggccgccctcacggacggccgcgcgatg
gacgtgtggaagcgcatgatccgcgcacaggacggagatccggatgccgccctccccacg
ccgcgcgagacccacacggtcgtcgccgagcgttcgggggtcgtgacgcgcgtcgaggct
ctgccgttcggcatcggcgcgtggcgtctgggcgccggccgcgcacgggccgaggacgcc
gtcgtgcacgccgcgggcatcgacctgcacgtcacggtcggccagtcggtcacggccggt
cagccgctgttcaccctgtcggccgatgaggagtcgcgcttcgagcgcgctctcggcgcc
gtcgagggcgcgctggagatcggcgacacggcccccgccgcctcgccgctcgtgcgcgag
cggatcaccgcgtga

DBGET integrated database retrieval system