KEGG   Microbacterium testaceum: MTES_0625Help
Entry
MTES_0625         CDS       T01423                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mts  Microbacterium testaceum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_0625 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTES_0625 (sdhD)
   00650 Butanoate metabolism
    MTES_0625 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MTES_0625 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667031..667489
Genome map
AA seq 152 aa AA seqDB search
MSVAQEASTIPAPRTPSVRKKGSNLEKWGWIYMRASGVLLLVLIFGHLFVNLMLGDGIHQ
IDFAFVAGKLASPFWQWWDVLMLWLALIHGANGMRTIVNDYVTNAAVRKVLVWSLWLSAG
LLILLGTLVVFTFDPCLGVTESSTLWDACQAA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgcccaggaagccagcacgattcccgccccgcgcacgccgagcgtgcgcaag
aaaggctccaacctcgagaagtggggctggatctacatgcgcgcctccggcgtgcttctt
ctcgtcctgatcttcggccacctgttcgtcaacctcatgctcggcgacggtatccaccag
atcgacttcgcgttcgtcgccggcaagctcgcctcgccgttctggcagtggtgggacgtg
ctgatgctgtggttggccctcatccacggcgccaacggcatgcgcacgatcgtgaacgac
tacgtcacgaacgccgcggtccgcaaggttctcgtgtggtcgctgtggctgtcggccgga
ctgctgatcctcctcggcaccctcgtggtcttcaccttcgacccctgcctcggcgtcacc
gagagcagcaccctctgggacgcgtgccaggcggcgtga

DBGET integrated database retrieval system