KEGG   Microbacterium testaceum: MTES_0625Help
Entry
MTES_0625         CDS       T01423                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mts  Microbacterium testaceum
Pathway
mts00020  Citrate cycle (TCA cycle)
mts00190  Oxidative phosphorylation
mts00650  Butanoate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01200  Carbon metabolism
Module
mts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mts_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTES_0625 (sdhD)
   00650 Butanoate metabolism
    MTES_0625 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MTES_0625 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAJ73589
UniProt: E8NCE1
Position
667031..667489
Genome map
AA seq 152 aa AA seqDB search
MSVAQEASTIPAPRTPSVRKKGSNLEKWGWIYMRASGVLLLVLIFGHLFVNLMLGDGIHQ
IDFAFVAGKLASPFWQWWDVLMLWLALIHGANGMRTIVNDYVTNAAVRKVLVWSLWLSAG
LLILLGTLVVFTFDPCLGVTESSTLWDACQAA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgcccaggaagccagcacgattcccgccccgcgcacgccgagcgtgcgcaag
aaaggctccaacctcgagaagtggggctggatctacatgcgcgcctccggcgtgcttctt
ctcgtcctgatcttcggccacctgttcgtcaacctcatgctcggcgacggtatccaccag
atcgacttcgcgttcgtcgccggcaagctcgcctcgccgttctggcagtggtgggacgtg
ctgatgctgtggttggccctcatccacggcgccaacggcatgcgcacgatcgtgaacgac
tacgtcacgaacgccgcggtccgcaaggttctcgtgtggtcgctgtggctgtcggccgga
ctgctgatcctcctcggcaccctcgtggtcttcaccttcgacccctgcctcggcgtcacc
gagagcagcaccctctgggacgcgtgccaggcggcgtga

DBGET integrated database retrieval system