KEGG   Microbacterium testaceum: MTES_0631Help
Entry
MTES_0631         CDS       T01423                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mts  Microbacterium testaceum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mts03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673623..674486
Genome map
AA seq 287 aa AA seqDB search
MPEMPEVEGLVEFLRGRVTGLQVSKATVSAINALKTYDPPLTALVGSAVTAVDRHGKFVD
VSTDAGVHLIFHLAKAGWLRWYDALPSTIIKPGKTPIALRVGFDDGSGFDLTEAGTKKSL
AVYAVRSPDEVPGIARLGPDPLSEGFDRATFGALLTGRRTQIKGVLRDQSIIAGVGNAYS
DEILHAAKMSPYALAATLTDDEVDRLFRAMVETLTEAIDEARGKPPAELKDAKRRGMRVH
GRRGEACPVCGDEVRSVYFADNSLEYCPTCQTGGKLLADRRLSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatgcctgaggtcgagggactcgtcgagttcctgcgtggtcgtgtgacgggg
ctgcaggtgtcgaaggccaccgtgtcggcgatcaacgcgctgaagacctacgacccgccc
ctgacggcgctcgtgggctcggcggtgaccgccgtggaccggcacggaaagttcgtcgac
gtctcgaccgacgccggcgtccacctgatcttccacctggcgaaagcgggctggctgcgc
tggtacgacgcgctgccctccacgatcatcaagccgggtaagacgccgatcgcgctccgt
gtcggtttcgacgacggatcgggtttcgatctcaccgaggccggcaccaagaagtccctc
gccgtctacgccgtacgctcacccgacgaggtcccgggcatcgcccgactcggccccgat
ccgctgagcgagggtttcgaccgagccacgttcggtgcgctcctcaccggccggcgcacc
cagatcaagggggtgctgcgcgatcaatcgatcatcgccggggtcggcaacgcgtactcc
gacgagatcctgcacgcggcgaagatgtcgccctacgccctcgccgcgacgctcaccgac
gacgaggtcgaccggctcttccgcgcgatggtcgagaccctcaccgaggcgatcgatgaa
gcgcgcggcaagccaccggcggagttgaaggatgccaagaggcgcggcatgcgcgtgcac
gggcgacgcggcgaagcatgtccggtgtgcggcgacgaggtgcgaagcgtgtacttcgcc
gacaactcgctcgagtactgccccacgtgccagaccggagggaagctgttggccgaccgg
aggctctctcggctgttgaagtga

DBGET integrated database retrieval system