KEGG   Microbacterium testaceum: MTES_0645Help
Entry
MTES_0645         CDS       T01423                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mts  Microbacterium testaceum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTES_0645
Enzymes [BR:mts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MTES_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689994..690596
Genome map
AA seq 200 aa AA seqDB search
MTELTAVAATHITPDLDAAEEGIRMYMRAIGLDTEHPTLIDTPRRVAHAGLDLFSGMAGD
PHRALGGGEPIEGVYPGPVAVHDIPYSSMCEHHLLPFQGTVSVAYLPDRALAGIGDFDAM
LRVLAARPQMQERLADQIAEVVSDTLGAKGVLVRLTAQHACMWARGERTVGSTAFSLASR
GIYDTDAAARAEARVLLGLH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcaccgccgtcgccgccacccacatcacccccgacctggatgccgcggag
gagggcatccgcatgtacatgcgcgcgatcggtctcgacaccgagcaccccaccctcatc
gacactccgcgccgcgtcgcgcacgccggcctcgacctcttttcggggatggcgggcgat
cctcatcgcgcgctcggcggcggcgagcccatcgagggcgtctaccccggacccgtggcg
gtgcacgacatcccctactcctcgatgtgcgagcatcacctgctgccgttccagggcacc
gtgtcggtggcctacctgcccgaccgcgcgctcgccgggatcggggacttcgacgcgatg
ctgcgcgtgctcgccgcccgcccgcagatgcaggagcgcctggccgaccagatcgccgag
gtcgtctccgacacgctcggcgcgaagggcgtgctcgtccggttgaccgcgcagcacgcg
tgcatgtgggctcgcggcgaacgcaccgtcgggtcgacggcgttctccctcgcgtcccgc
gggatctacgacaccgacgccgcggctcgggccgaggcacgggtgctgctcggactgcac
tga

DBGET integrated database retrieval system