KEGG   Microbacterium testaceum: MTES_0885Help
Entry
MTES_0885         CDS       T01423                                 

Definition
cellobiohydrolase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mts  Microbacterium testaceum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTES_0885
Enzymes [BR:mts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MTES_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926866..927972
Genome map
AA seq 368 aa AA seqDB search
MGAVVVVVALIAGIAVVGSLVSSLFQTLGARPPAVDTKIVAPDESKAAIAANDPSATPEQ
AAAAKWLAAQPTTYWLTPEIDPVDEIWDRIAHLASEARDQDASLSVAVYGLPDRDCGNHS
AGGLDPDSYREWTKRIGDALRNAPDIQKIVILEPDSIALSSSCGSPSDRAGYLRTAVENI
RGTNTWIYLDGGHSAWHPVDEMASLISSTGLIGDVQGHRAQRVELSGHGRRVRLRPRAFR
EARRNARRHRHVSQRCGPGGIGMVQPSGSARGPRRGLLRRRGGRHHALDQTGRRERRRVQ
WRTPRGHLVARSRGRTHTREPLTHAAPTTATPPGGARKCVKMWLGPCDRRVSGENAGTFP
CEPEEWVR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgccgtggtggtcgtcgtcgcgctcatcgccgggatcgccgtggtcgggagcctc
gtctcttcgctcttccagaccctgggggctcgccctcccgcggtggacacgaagatcgtc
gctccggatgagtcgaaggctgcgatcgcggccaatgacccgtccgccacgcccgagcag
gccgcggccgcgaagtggctcgccgcccagcccacgacctactggctgacacccgagatc
gaccccgtcgacgagatctgggaccggatcgcgcatctggcttccgaagcacgggatcag
gatgcctccctctcggtcgccgtatacggattgcccgatcgcgactgcgggaaccactcc
gccggcggactggaccccgattcgtatcgagagtggacgaagcggatcggcgacgcgctg
cgcaacgccccggacatccagaagatcgtcatcctcgagccggacagcatcgctctgtcc
tcgtcctgcgggtcgccgtcggatcgtgcggggtacctccgcacggccgtcgagaacatc
cgcggcacgaacacgtggatctacctcgacggagggcactccgcgtggcatcccgtcgac
gagatggcgtcgctcatctcctccaccggactcatcggggatgtccaggggcatcgcgct
caacgtgtcgaactatcaggacacggccgccgagttcgcctacgcccacgcgctttccga
gaagctcggaggaacgcacgccgtcatcgacacgtctcgcaacggtgcgggcccggcggg
atcggaatggtgcaaccctccgggtcggctcgtgggccccgccgggggctccttcggcga
cggggtggtcgacaccacgctctggatcaaaccggccggagagagcgacggcgagtgcaa
tggcggaccccccgcgggcacctggtggcccgaagccgcggtcgaactcacacgcgagag
ccgctgacgcacgcggcccccaccaccgccaccccgcccgggggtgcccggaagtgtgta
aaaatgtggctcggtccgtgtgaccgccgtgtctcgggggagaacgcgggcacgtttccg
tgcgaaccagaagagtgggtgcgatga

DBGET integrated database retrieval system