KEGG   Microbacterium testaceum: MTES_1076Help
Entry
MTES_1076         CDS       T01423                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mts  Microbacterium testaceum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mts00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1134460..1134987)
Genome map
AA seq 175 aa AA seqDB search
MSVRLAHGIGDPPRDAEMPAVVALGANLGDRAETLRAAVNALRALPLTTAVRVSKPLETV
AVTVHGEDADAPRYLNAVALVSTRLAPRALLRELHRIEADHGRVRRERWGDRTLDLDLIA
YADERIDDEDLTVPHPRAHEREFVLAPWLDVDPDAEIPGRGRVEDLLRELRGGAR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgtctggcccacggcatcggcgacccgccgcgggacgccgagatgcccgcg
gtggtggctctcggcgcgaatctcggtgaccgcgccgagaccctgcgagcggccgtcaat
gcgctccgcgctctgcccctcacgacagcggtgcgggtgtcgaagccgctggagaccgtc
gcggtcaccgtgcacggggaggatgccgacgccccgcgctacctcaacgccgtcgcgctc
gtgtcgacgcggctcgccccgcgcgccctcctccgagagctccaccgcatcgaggccgac
cacggccgcgtgcgccgcgagcgctggggggaccgcacgctcgatctcgacctgatcgcg
tacgccgacgaacgcatcgacgacgaggacctcacggtgccgcacccccgcgcgcacgag
cgggagttcgtcctcgcgccgtggctcgacgtggatccggatgccgagatcccgggacgc
ggccgcgtcgaggacctgctgcgcgagctgcggggaggtgcacgatga

DBGET integrated database retrieval system