KEGG   Microbacterium testaceum: MTES_1078Help
Entry
MTES_1078         CDS       T01423                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mts  Microbacterium testaceum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTES_1078
Enzymes [BR:mts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MTES_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1135352..1136143)
Genome map
AA seq 263 aa AA seqDB search
MTLIMAIVNVTPDSFSDGGRYLDPDVAIAHARSLRAQGADLLDIGGESTRPGAERVAPRV
EQQRVLPVVEALASEGAVVSIDTMNASTARAAVAAGARLVNDVSGGLADPEMLAAVAETD
AEIALGHWRGPSSDMYARADYADAGREVADELAERVAAARAAGIASDRIIVDPGVGFGKR
GIQNWRVLNAIPTLAALGSRVLIGTSRKRFLAEVLGEDADLTRRDLATAVTSALAARSGA
WAVRVHDVPTTRDALAVARAWEA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcatcatggcgatcgtcaacgtgaccccggactccttcagcgacggcgggcgc
tacctcgaccccgacgtggcgatcgcacacgcgcgctccctgcgcgcccaaggggcggac
ctcctcgacatcgggggcgagtccacgcggccgggtgccgagcgcgtcgcccctcgggtg
gagcagcagcgcgttctgccggtcgtcgaggcgctggcatccgagggggccgtcgtcagc
atcgacacgatgaacgcttcgacggcgcgcgccgcggtcgccgcgggcgcgcgcctcgtc
aacgatgtgtcgggaggtctcgccgatcccgagatgctcgccgcggtcgccgagaccgac
gcggagatcgccctgggacactggcgcggtccctcctccgacatgtacgcgcgcgccgac
tacgccgacgcgggccgagaggtcgccgacgagctggccgaacgggtggcggcggcccgc
gccgcgggaatcgcctcggaccgcatcatcgtcgacccgggtgtgggcttcgggaagcgt
ggcatccagaactggcgggttctgaacgcgatccccaccctcgccgcgctcggatcccgc
gtgctgatcggcaccagtcgcaagcgtttcctcgccgaggtgcttggcgaggacgccgat
ctcacccgccgcgacctcgcgaccgccgtcacgagtgcgctggccgcgcggtccggcgcg
tgggccgtccgcgtgcacgatgttccgaccacccgcgacgcgctcgccgtcgcccgcgcc
tgggaggcctga

DBGET integrated database retrieval system