KEGG   Microbacterium testaceum: MTES_1079Help
Entry
MTES_1079         CDS       T01423                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mts  Microbacterium testaceum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mts00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1136140..1136727)
Genome map
AA seq 195 aa AA seqDB search
MAVDRERVAALVRELLEAIGEDPDRPGLRQTPTRVADSWSEFFGGVGQDATAPLQHTISV
TRGPAPDTLPSGAVMLRDIAFRSMCEHHLLPFRGRAHVAYLPGEEVVGLGALPRVIDILA
ARPQVQERLGEQVADAVASALDARGVLVVLDAVHECVTMRGGRQLDASTVTIAARGAYTD
AVARAELVALIGARA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgaccgggagcgcgtcgccgcgctcgtacgcgagttgctcgaggcgatcggg
gaggatcccgatcgccccgggctccgccagacgccgacccgcgtggccgattcgtggagc
gagttcttcggcggagtgggtcaggatgccaccgcccccctgcagcacaccatctcggtg
acgcgcggaccggcgccggacacccttccgtccggtgccgtgatgctgcgggacatcgcc
ttccgctcgatgtgcgagcaccatctcctccctttccgcgggcgtgcccatgtggcgtat
ctgcccggggaagaggtcgtgggtctcggagcgctgccccgggtgatcgacatcctggcg
gcacgccctcaggtgcaggagcggctcggtgagcaggtcgccgacgccgtggcatccgct
ctcgatgcgcggggtgttctcgtggtgctcgacgccgtccacgagtgcgtgaccatgcgc
ggcggccgccagctcgacgcgtcgaccgtcacgatcgccgcgcgcggcgcgtacaccgac
gccgtcgcccgggccgagctcgtcgccctgatcggggcacgagcgtga

DBGET integrated database retrieval system