KEGG   Microbacterium testaceum: MTES_1165Help
Entry
MTES_1165         CDS       T01423                                 

Definition
ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mts  Microbacterium testaceum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MTES_1165
Enzymes [BR:mts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MTES_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243027..1243752)
Genome map
AA seq 241 aa AA seqDB search
MTGAGTTRPDAARASDAAGLDAAGLDAGGSDARERVAAVCRALAADGLVKGTAGNVSVRV
DGGIAITATGVVFAEAVADDVVVVGDDRRLVRGSLAPSSELDLHLAAYADDAVGAVVHTH
APAAVAVSLISDRLPCVHYQQLTLGGEIEVVPFSVFGSRELAEATGDALSSANAVILAHH
GAVTTGRDLADAVAHTALLEWACDIYLRARAAGEPAELSPAQQADVVAAAVATGYGQKHE
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgcggggacgacccggcccgatgccgcccgggcgtccgacgccgcggggctc
gacgccgcggggctcgatgccggcgggtccgacgcccgcgaacgcgtggcggccgtgtgt
cgcgcgctcgcggccgacgggctggtgaaagggaccgcgggcaacgtgagcgtccgcgtc
gacgggggcattgcgatcaccgcgaccggagtggtcttcgccgaggcggtcgcggacgac
gtggtggtcgtcggcgatgatcgacgcctcgtgcgggggagcctcgcccccagctccgag
ctggacctgcacctcgccgcgtacgcggacgacgcggtgggtgccgtcgtgcacacccac
gctccggcagccgtcgccgtgtcgctgatctccgaccgccttccctgcgtgcattaccaa
cagctcaccctcggcggcgagatcgaggtcgtcccgttctcggtgttcggctctcgcgag
ctcgccgaggccacgggcgatgccctgtccagcgcgaacgcggtgatcctcgcgcaccac
ggggccgtgacgaccggccgcgatctcgccgacgccgtcgcgcacaccgcgctgctggag
tgggcgtgcgacatctacctgcgcgcccgcgccgcgggggagccggccgagctcagcccc
gcgcagcaggccgacgtcgtcgccgcggcggtggccaccggatacgggcagaagcacgag
gcgtga

DBGET integrated database retrieval system