KEGG   Microbacterium testaceum: MTES_1350Help
Entry
MTES_1350         CDS       T01423                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mts  Microbacterium testaceum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MTES_1350
  Lipid metabolism
   00561 Glycerolipid metabolism
    MTES_1350
   00600 Sphingolipid metabolism
    MTES_1350
Enzymes [BR:mts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MTES_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437469..1439625
Genome map
AA seq 718 aa AA seqDB search
MTTTQPAATGAQPTLAWGNDRVTLTFDWDAESPVTCSAVTVAGRTVPVHRVPAVEVLTAD
AGHRPASGRLAHTEHGARLRYVDHREIDENGTRRLVIRERSGDLEVRLELTARDGVAAIT
SRVIASNLGDGRIVLRAVASWVAGFTARDHSGDALAGWERLTGTNDWLGEGRWTRTPLRG
PDFVPLAEHLTGHNPRGALAAVSTGTWSTAHQLPTGILESREASLALAWQIEHNGAWRWE
IGEDTAGGYLALSGPTDADSGWSRVLAPAESFESVPATLALGIDAVAAIGALTDHRRATR
RAHRDNTAMPVIFNDYMNTLDGDPTAEKLLPLIRAAAGVGAEAFCIDAGWYDDSGYWWDS
VGAWMPSTTRFPSGFGEVIDAIHAEGMIAGLWLEPEVVGIQSPIADALPAEAFLQRNGER
VVEHDRFHLDLRHPAARAHLDAVVDRLVSEFGIGFFKIDYNINPGPGTDRDADSVGDGLL
RHNRAHLDWLDGVLDRHPDLIVENCSSGAMRMDYAMLSRLAMQSTSDQQDFRKYPPIAAS
APMSILPEQAASWAYPQPEMDAEESAFCLVTGLLGRFYVSGHLNRMGDEQRTRVATAIAV
AKDLRGEIATAHPHWPLGLPRWDDAWVALGLRGTDSDLVSIWRRGGANATTLSFPHLVGH
DVEVTPVFPLDLPAWHSDWDATTGTLHVRGTDTRLAARTLRLSYRLPEVDDDARTGSH
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgcaacccgcagccaccggcgcgcagcccaccctggcgtggggcaacgac
cgggtgacgctgacgttcgactgggatgccgagtcgcccgtcacctgctccgccgtcacc
gtcgccggccgcaccgtgcccgtgcaccgcgtccccgccgtcgaggtcctcaccgcagat
gccggccaccgccccgcctccgggcgcctcgcccacaccgagcacggcgcgcggctccga
tatgtcgaccaccgcgagatcgacgagaacggcacccgccggctcgtgatccgggaacgc
tcgggcgacctcgaggtgcgcctcgagctgaccgcgcgcgacggggtcgccgccatcacc
agccgcgtgatcgcgagcaacctcggcgacggacgcatcgtgctccgcgccgtcgcgtcg
tgggtggccggattcaccgcccgtgatcactccggcgacgccctcgccggatgggagcgc
ctcacgggcaccaacgactggctcggcgagggtcggtggacgcgcactcccctgcgcggt
cccgacttcgttcccctcgccgagcacctcaccggacacaacccgcgcggagcgctggcc
gccgtctccacggggacgtggtcgaccgcgcaccagctgccgaccggcatcctggaatcc
cgtgaggcatccctcgccctcgcctggcagatcgagcacaacggcgcgtggcggtgggag
atcggcgaggacaccgcgggcggctacctcgcgctgtccggccccaccgacgccgactcc
gggtggagtcgcgtcctcgccccggccgagagcttcgagagcgtccccgcgacgctcgcc
ctcggcatcgatgccgtggccgcgatcggggccctgaccgaccaccgtcgggccacgcgc
cgggcgcaccgtgacaacaccgcgatgccggtgatcttcaacgactacatgaacaccctc
gacggcgaccccaccgccgagaagctcctccccctcatccgcgccgcggccggagtgggc
gccgaggcgttctgcatcgacgccggctggtatgacgactcgggctactggtgggactcg
gtgggggcctggatgccgtcgaccacccgcttcccgagcggattcggcgaggtgatcgac
gcgatccacgccgaggggatgatcgccggactctggttggagcccgaggtggtcggcatc
cagagtccgatcgccgatgctcttcccgcggaggcgttcctccagcgcaacggggagcgc
gtggtggagcacgaccggttccatctcgatctgcgtcacccggccgcgcgcgcgcacctc
gacgccgtcgtcgaccgcctggtgtccgagttcgggatcggcttcttcaagatcgactac
aacatcaaccccggacccggcaccgaccgcgacgccgacagcgtcggcgacggcctgctc
cgccacaaccgcgcgcacctggactggctcgacggcgtgctggatcggcatccggatctc
atcgtcgagaactgcagctccggcgcgatgcgtatggactacgcgatgctctcgcgcctg
gcgatgcagtcgacctcggaccagcaggacttccgcaagtacccgccgatcgcggcgagc
gcgccgatgtcgatcctccccgagcaggccgcgagctgggcctacccccagcccgagatg
gatgccgaggagtcggcgttctgtctggtcacgggcctgctgggtcgcttctacgtgtcg
gggcacctcaaccgcatgggcgacgagcagcgcacgcgcgtcgccaccgcgatcgctgtc
gcgaaggacctgcgcggcgagatcgcgaccgcgcacccgcactggccgctcggtctcccc
cgctgggacgacgcgtgggtcgcgctgggtctgcgcggcaccgacagcgacctcgtctcg
atctggcggcgaggcggcgcgaacgcgaccaccctgtcgttcccccacctcgtcggtcac
gacgtcgaggtgaccccggtcttccccctggacctccccgcctggcactccgactgggat
gccacgacgggaaccctccacgtgcgcggcaccgatacccgtctcgccgcgcgcaccctg
cgtctgtcatatcgactccccgaggtcgacgacgacgcccgcaccggatcacactga

DBGET integrated database retrieval system