KEGG   Microbacterium testaceum: MTES_1436Help
Entry
MTES_1436         CDS       T01423                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_1436
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_1436
   00052 Galactose metabolism
    MTES_1436
   00500 Starch and sucrose metabolism
    MTES_1436
   00520 Amino sugar and nucleotide sugar metabolism
    MTES_1436
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTES_1436
   00524 Butirosin and neomycin biosynthesis
    MTES_1436
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MTES_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522116..1523021
Genome map
AA seq 301 aa AA seqDB search
MTLLLGVDNGGTRVKLLLARETDGRLEHVRTSDAPTPRGPAAMDELATLTRAFLADDRAD
AFGLTVAGILDEASGVVSTSANMRWLEGLAPARELSDRLGIPGEAVQDGVATAIAEAVLG
AGRGAEDVFVLALGTGIAGAHVVDGSVRKGAHGGAGEIGHIATGGDEMCTCGQSGCLESV
LGGTRLGARWDRARGVDTQSTALDVVLAAERGDGTARAILDEATTALANGLLSVMAMIDP
GVIVIGGGLSNSPAWIIDPAIEKAHRRATFHAVPPIIRAQLGSWAGAWGAVLTAGHRMEL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttctgggagtggacaacgggggcacgcgggtcaagctgctgctcgcgcgc
gagaccgacggacggctcgagcacgtgcgcacgagcgacgcgccgaccccgcgcggaccc
gcggcgatggacgagctggccaccctgacgcgggcgttcctcgccgacgaccgagccgac
gcgttcggtctcaccgtcgcgggaatcctcgacgaggcatccggcgtcgtctccacgagc
gcgaacatgcgctggctcgaggggctcgcgcccgctcgcgagctgtcggatcgactcggc
atccccggagaggccgtccaggacggcgtcgccacggcgatcgcggaggcggttctcggc
gccggacggggagccgaggacgtgttcgtgctggccctcggcaccggcatcgccggcgct
cacgtcgtcgacggatcggtgcgcaagggcgcccacggcggcgcgggagagatcggccac
atcgccacgggcggagacgagatgtgcacctgcgggcagtcgggatgcctcgagtcggtg
ctgggcggcacgcgcctcggcgcccgctgggatcgcgcgcgcggggtcgacacgcagtcg
accgccctcgacgtggtcctcgccgccgagcgcggggacggcaccgcgcgcgcgatcctg
gacgaggccaccacggctctcgccaacgggctgctgagcgtgatggcgatgatcgacccc
ggggtgatcgtcatcggcggcgggctgtcgaactcccccgcctggatcatcgaccccgcg
atcgagaaggcccatcgccgcgcgaccttccacgcggttccccccatcatccgcgcgcag
ctcgggtcgtgggccggggcgtggggcgccgtgctgacggcggggcacagaatggagctg
gtctga

DBGET integrated database retrieval system