KEGG   Microbacterium testaceum: MTES_1696Help
Entry
MTES_1696         CDS       T01423                                 

Gene name
hmuO
Definition
(GenBank) heme oxygenase
  KO
K21480  
heme oxygenase (biliverdin-producing, ferredoxin) [EC:1.14.15.20]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTES_1696 (hmuO)
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.20  heme oxygenase (biliverdin-producing, ferredoxin)
     MTES_1696 (hmuO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1802943..1803596)
Genome map
AA seq 217 aa AA seqDB search
MNAVVPFSAALHERASSAHSPRECDGFMADLLNGTGSRDDYIALIAQHWFIYEALETAAA
RMRHDPVASVFLSDKLTRLPALEADLAFLLGPEWRAQISALPTTQAYVSRIRRVAATWPG
GFVAHHYTRYLGDLSGGPFIGRLMQRRFGFDTNGIGFFLFGDIADPRAFKNVYREQLDAV
PWDDDEKARVIDEVLVAYRFNTELFADLARAKASQVA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgtcccgttctccgccgctctccacgagcgcgccagcagcgcccactcc
ccgcgcgagtgcgacggcttcatggccgacctcctgaacggcacgggctcgcgcgacgac
tacatcgccctcatcgcgcagcactggttcatctacgaagcgctcgagaccgccgccgcg
cgcatgcgccacgaccccgtggcatccgtgttcctcagcgacaagctcacgcgcctgccc
gccctggaggccgacctcgcgttcctcctcgggcccgagtggcgcgcgcagatctcggcg
ctccccacgacgcaggcgtacgtgtcgcgcatccgtcgcgtcgccgccacgtggcccggc
ggcttcgtcgcgcaccactacacgcgctacctcggcgacttgtccggcgggccgttcatc
ggccgcctcatgcagcgtcgcttcgggttcgacacgaacgggatcgggttcttcctcttc
ggcgacatcgccgacccgagggccttcaagaacgtctaccgcgagcagctggacgccgtc
ccgtgggacgacgacgagaaggcgcgcgtcatcgacgaggtgctcgtcgcctaccggttc
aacaccgagctgttcgcggacctcgcccgcgcgaaggcgtctcaggtcgcctga

DBGET integrated database retrieval system