KEGG   Microbacterium testaceum: MTES_1696Help
Entry
MTES_1696         CDS       T01423                                 

Gene name
hmuO
Definition
(GenBank) heme oxygenase
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTES_1696 (hmuO)
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     MTES_1696 (hmuO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1802943..1803596)
Genome map
AA seq 217 aa AA seqDB search
MNAVVPFSAALHERASSAHSPRECDGFMADLLNGTGSRDDYIALIAQHWFIYEALETAAA
RMRHDPVASVFLSDKLTRLPALEADLAFLLGPEWRAQISALPTTQAYVSRIRRVAATWPG
GFVAHHYTRYLGDLSGGPFIGRLMQRRFGFDTNGIGFFLFGDIADPRAFKNVYREQLDAV
PWDDDEKARVIDEVLVAYRFNTELFADLARAKASQVA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgtcccgttctccgccgctctccacgagcgcgccagcagcgcccactcc
ccgcgcgagtgcgacggcttcatggccgacctcctgaacggcacgggctcgcgcgacgac
tacatcgccctcatcgcgcagcactggttcatctacgaagcgctcgagaccgccgccgcg
cgcatgcgccacgaccccgtggcatccgtgttcctcagcgacaagctcacgcgcctgccc
gccctggaggccgacctcgcgttcctcctcgggcccgagtggcgcgcgcagatctcggcg
ctccccacgacgcaggcgtacgtgtcgcgcatccgtcgcgtcgccgccacgtggcccggc
ggcttcgtcgcgcaccactacacgcgctacctcggcgacttgtccggcgggccgttcatc
ggccgcctcatgcagcgtcgcttcgggttcgacacgaacgggatcgggttcttcctcttc
ggcgacatcgccgacccgagggccttcaagaacgtctaccgcgagcagctggacgccgtc
ccgtgggacgacgacgagaaggcgcgcgtcatcgacgaggtgctcgtcgcctaccggttc
aacaccgagctgttcgcggacctcgcccgcgcgaaggcgtctcaggtcgcctga

DBGET integrated database retrieval system