KEGG   Microbacterium testaceum: MTES_1696Help
Entry
MTES_1696         CDS       T01423                                 

Gene name
hmuO
Definition
heme oxygenase
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mts00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802943..1803596)
Genome map
AA seq 217 aa AA seqDB search
MNAVVPFSAALHERASSAHSPRECDGFMADLLNGTGSRDDYIALIAQHWFIYEALETAAA
RMRHDPVASVFLSDKLTRLPALEADLAFLLGPEWRAQISALPTTQAYVSRIRRVAATWPG
GFVAHHYTRYLGDLSGGPFIGRLMQRRFGFDTNGIGFFLFGDIADPRAFKNVYREQLDAV
PWDDDEKARVIDEVLVAYRFNTELFADLARAKASQVA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgtcccgttctccgccgctctccacgagcgcgccagcagcgcccactcc
ccgcgcgagtgcgacggcttcatggccgacctcctgaacggcacgggctcgcgcgacgac
tacatcgccctcatcgcgcagcactggttcatctacgaagcgctcgagaccgccgccgcg
cgcatgcgccacgaccccgtggcatccgtgttcctcagcgacaagctcacgcgcctgccc
gccctggaggccgacctcgcgttcctcctcgggcccgagtggcgcgcgcagatctcggcg
ctccccacgacgcaggcgtacgtgtcgcgcatccgtcgcgtcgccgccacgtggcccggc
ggcttcgtcgcgcaccactacacgcgctacctcggcgacttgtccggcgggccgttcatc
ggccgcctcatgcagcgtcgcttcgggttcgacacgaacgggatcgggttcttcctcttc
ggcgacatcgccgacccgagggccttcaagaacgtctaccgcgagcagctggacgccgtc
ccgtgggacgacgacgagaaggcgcgcgtcatcgacgaggtgctcgtcgcctaccggttc
aacaccgagctgttcgcggacctcgcccgcgcgaaggcgtctcaggtcgcctga

DBGET integrated database retrieval system