KEGG   Microbacterium testaceum: MTES_1862Help
Entry
MTES_1862         CDS       T01423                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTES_1862
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MTES_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987524..1989026
Genome map
AA seq 500 aa AA seqDB search
MSEPLDRLARQASETHVVVAGGGIAGLVAARECAKVGLRVTVLEASDAFGGVVRSAEVGG
LTLDVGAESFATRGGVVSALLDELGLADAVVSPNPAGAWVAGVPGVGAAPLPKGGVLGIP
DNPFSPDVRRIIGWSGTWRAYLDRLRPPLTIGHQRSLGTLVRTRMGARVLDRLVAPVTSG
VYSARPDDIDVDLAAPGLNAALTRTGSLSGAVAEMRLSRTTAKPADAPASDVPAADGRKA
PAPGGAVQGIAGGMSRLVDALVAQLEELGVELRTGTPVEELAAAGAGWSVTTSDDADPIA
ADAVIVALPEGPARALLAPVVPALEAGDPVAPVVEVVTLVVDAPALDAAPRGTGVLTVPG
SHVAKALTHSTAKWDWVRDATAPGVHVVRVSFGAQGEEPATAELDDDAAAHLALSEAAAM
FGVELPASTLRASRRVRYVQSQPAATIGRAAETAAARGAVHAIAGLGVTGAWVAGTGLAQ
VIPDARAEADRVRSAALWHH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgctcgatcgcctcgcccgccaggcgtccgagacccacgtcgtcgtggcc
ggtggcgggatcgccggcctcgtcgccgcccgggagtgcgcgaaggtcggattgcgcgtg
accgtgctcgaggcctccgacgcgttcggcggcgtcgtccgctcggcggaggtcggggga
ctcaccctcgacgtcggcgccgagagcttcgccacccgcggcggcgtcgtgagcgcgctg
ctcgacgagctcggtctcgccgacgccgtcgtctcgccgaaccccgccggtgcgtgggtc
gcaggagtgccgggagtcggggcggctcccctcccgaagggcggggtgctcggcatcccg
gacaatcccttctcccccgacgtccgccgcatcatcggctggagcggaacctggcgcgcg
tacctggatcgcctgcgtcccccgctgacgatcggtcaccagcgcagcctcggcaccctc
gtgcgcacccgcatgggcgcgcgcgtgctcgatcggctggtcgctccggtgacgagcggg
gtgtactccgcgcgtcccgacgacatcgacgtcgacctcgccgcgccggggctgaacgcc
gccctcacgcggacgggctcgctgtcgggagcggtcgccgagatgcggctcagccgcacg
acggccaagcccgcggacgccccggcctccgacgttcccgcggcagacggtcgcaaggcg
cccgcccccgggggagccgtgcagggcatcgcgggcgggatgtcgcgcctcgtcgacgcc
ctggtcgcccagctcgaggagctcggcgtcgagctgcgcacgggaaccccggtcgaggag
ctcgccgccgcaggtgcgggctggagcgtcacgacctccgacgacgccgacccgatcgcc
gcggacgcggtgatcgtcgcgctgcccgaggggccggcccgcgcgctcctcgccccggtc
gtgcctgccctcgaggcgggagaccccgtcgcgccggtggtcgaggtcgtcaccctcgtc
gtcgacgcccccgccctcgacgcggcgccccgcggaaccggcgtcctcaccgtgcccgga
agccacgtcgcgaaggcgctcacgcattcgacggccaagtgggactgggtccgggatgcc
accgcccccggcgtccacgtcgtccgggtctcgttcggtgcccagggcgaagagcccgcc
accgccgagctcgacgacgacgcggcggcccacctcgccctgtcggaggcggcggcgatg
ttcggcgtggaactgccggcatccactctccgtgcctctcgccgggtgcgctacgtgcag
tcgcagcccgcggcgacgatcggccgcgcggccgagaccgccgcagcgcgcggtgcggtg
cacgcgatcgccgggctcggggtgacgggggcgtgggtcgccggaacgggactcgcgcag
gtgatccccgacgcgcgcgccgaggcggaccgcgtccgcagcgcggcgctgtggcaccac
tga

DBGET integrated database retrieval system