KEGG   Microbacterium testaceum: MTES_1869Help
Entry
MTES_1869         CDS       T01423                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTES_1869
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MTES_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992997..1993812
Genome map
AA seq 271 aa AA seqDB search
MNEGHWQTPTTSTGSVPKPLAGRRVLVPRGGPWGDGVAASLRQRGAVPVIAPLINFAPTN
DQATLEKALADLAAGAFDWLTLTSATTVDVLYAYRAEIPAETKVAVVGETTAAAMQAVGY
RVDLVPERDNSAQGMAEQMIDLESEPRKVLTLRSEIAKPVLTRLLIEAGHDVRSVVAYRT
VGVPVTEKIAGDVHSGRINAILVTSGSVAEQVVAQFPEIPASTVIAAIGPRTAKDAKRAG
LSVDVVAEKQTVESLIEAVARFPLAPDESTS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaggccactggcaaacgccgaccacctcgaccggcagcgtgcccaaaccgctc
gccggccgccgcgtgctcgtgccgcgcggtggcccctggggagacggcgtcgcggcgagt
ctgcgccagcgcggggccgttccggtcatcgcccccctcatcaacttcgcgcccacgaac
gatcaggcgaccctcgagaaggccctcgccgatctggcggccggagccttcgattggctg
actctcacgagcgcgaccaccgtcgacgtgctctacgcctatcgggccgagattcccgcc
gagacgaaggtcgccgtcgtcggtgagaccaccgccgcggcgatgcaggctgtcggctac
cgcgtcgacctcgtccccgagcgcgacaactccgctcagggcatggccgagcagatgatc
gacctcgaatccgagccgcgcaaggtgctgaccctccgcagtgagatcgccaagcccgtc
ctcacacgcctgctgatcgaggcgggccacgacgtccgcagcgtcgtcgcgtatcgcacg
gtcggcgtgccggtgaccgagaagatcgccggcgacgtgcactcgggacggatcaacgcg
atcctggtgaccagtggctcggtcgccgaacaggtggtcgcgcagttccccgagattccg
gcatccaccgtcatcgcggccatcggcccgcgcacggccaaggatgccaagcgcgccggg
ctcagcgtcgacgtggtcgccgagaagcagaccgtcgagtcgctcatcgaggccgtcgcc
cgtttccccctcgcccccgacgaatcgacctcatga

DBGET integrated database retrieval system