KEGG   Microbacterium testaceum: MTES_1870Help
Entry
MTES_1870         CDS       T01423                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mts  Microbacterium testaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mts00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1993809..1994792
Genome map
AA seq 327 aa AA seqDB search
MSFPEHRPRRLRRTPAVRRLARETHLVPSQLVLPMFVREGITEPSPIGSMPGIVQHSMDS
LRRAVAQAAEERIGGVMLFGVPETRDAVGSGADDPNGILNLATEAVVAEVGDALVVQTDL
CLDEFTDHGHCGVLQSDGSVDNDATLERYTAMGLAQARAGSAMLGLSGMMDGQVGAVRDA
LDAEGFTDTLILAYSAKYAGAFYGPFREAVDSQLKGDRRSYQLDPGNGREGVREALLDVE
EGADIVMVKPALPYLDVLADVRASVDVPVWAYQVSGEYAMVEAAAAHGWIDRRGAILESL
LGIRRAGADAILTYWAVEAARWLREEL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcccgagcaccgcccgcggcgtctgcgccgcacccccgccgtccgccgtctc
gctcgggagacgcacctcgtgccctcgcagctcgtgctgccgatgttcgtacgcgagggc
atcaccgagccgagcccgatcggctcgatgcccggcatcgtgcagcactcgatggactcg
ctccgccgcgcggtcgcgcaggccgcggaggagcgcatcggcggggtgatgctgttcggc
gtccccgagacgcgcgacgccgtgggttccggagccgacgatccgaacggcatcctgaac
ctcgccaccgaagctgtggtggccgaggtcggcgatgcgctcgtggtgcagaccgacctg
tgcctcgacgagttcaccgaccacgggcactgcggtgtgctgcagtccgacggttccgtc
gacaacgacgccaccctcgagcggtacaccgcgatgggcctcgcgcaggcgcgcgcgggt
tcggcgatgctcgggctgtcgggcatgatggacggccaggtcggcgcggtgcgcgacgca
ctggatgccgaggggttcaccgacacgctgatcctcgcgtactccgcgaagtacgccggg
gccttctacggcccgttccgcgaggccgtcgactcgcaactgaagggcgaccgtcgctcg
taccagctcgaccccggcaacggacgcgagggcgtgcgcgaagcgctgctcgacgtcgaa
gagggtgccgacatcgtcatggtgaagcccgcgctgccgtacctcgacgtgctcgccgac
gtccgcgcctcggtcgacgtgccggtgtgggcgtaccaggtgtcgggcgagtacgcgatg
gtcgaggccgccgcggcccacggctggatcgaccgccgcggcgcgatcctcgagagcctg
ctcggcatccgtcgtgccggcgccgacgcgatcctcacgtactgggccgtcgaggccgcc
cgctggctgcgcgaagaactctga

DBGET integrated database retrieval system