KEGG   Microbacterium testaceum: MTES_1946Help
Entry
MTES_1946         CDS       T01423                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mts  Microbacterium testaceum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mts00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2076127..2076879)
Genome map
AA seq 250 aa AA seqDB search
MLQVWALDGIREITPGDDLVRVILDALTEPLQDGDIVVVTSKIVSKAEGRIIRASDREDA
ITRETVRLVASRTSPTGHVTRIVENPLGIVSAAAGVDASNTPEGTVLLLPVDPDASARRI
AEGLRAVARVGVIITDTLGRAWREGQTDHAIGAGGIHVFEDLRGTVDAEGRPLVVTLPCV
ADELAAATDLVKGKASRRPVAIVRGRGDLVGELDLPGARSIVRDPERDMFRQGADEAYAE
GFAAGRAARD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaggtctgggccctcgacggcatccgtgagatcaccccgggggacgacctcgtc
cgggtgatcctggatgccctcacggaaccgctccaggacggcgacatcgtcgtcgtcacg
agcaagatcgtgtcgaaggccgaggggcggatcatccgggcctcggaccgcgaggacgcc
atcacgcgcgagaccgtgcggctcgtggcatcccgcacctcccccaccggacacgtgacc
cggatcgtcgagaaccccctggggatcgtctcggccgccgcgggagtcgacgccagcaac
acccccgagggcacggtgctcctcctccccgtcgaccccgacgcctccgcgcggcgcatc
gccgaggggctgcgcgccgtcgcccgggtcggcgtgatcatcaccgacaccctcggccgc
gcgtggcgcgaggggcagacggatcacgcgatcggggccggcggcatccatgtcttcgaa
gacctccgcggaacggtggatgccgagggccgcccgctcgtcgtgaccctgccgtgcgtg
gccgatgagctcgccgcggccaccgacctcgtcaagggcaaggcgtcgcgccgccccgtc
gcgatcgtgcgcgggcgcggagacctggtgggagagctcgacctccccggcgcgcgctcg
atcgtgcgcgaccccgagcgcgacatgttccgccagggcgccgacgaggcgtacgccgag
ggcttcgcggcgggccgcgccgcgcgcgactga

DBGET integrated database retrieval system