KEGG   Microbacterium testaceum: MTES_1960Help
Entry
MTES_1960         CDS       T01423                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mts  Microbacterium testaceum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mts00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2094798..2095379)
Genome map
AA seq 193 aa AA seqDB search
MTLLTVWKETDPSTPVLETTDEAEIRAALAELGARFSRWEVRDVPAGASQDEVLALYADE
IGEVKDREGYTLVDVVALDPAQENYDEVKTPSRQKFLSEHQHDDDEDRYFAKGAGVFYLH
ANEKVHAVYCEAGDLISVPANTTHWFDMGTAPHYVSVRFFHDDDGWVGHFTGSPIAESFA
TFDQLAERRAQLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcctgaccgtctggaaagagaccgacccgagcacgcccgtgctcgagaccacc
gacgaagcggagatccgtgcggcgctcgccgagctcggcgcgcgcttctcgcgctgggag
gtccgtgacgtccccgccggcgcgtcgcaggacgaggtactggcgctgtacgccgacgag
atcggcgaggtgaaggaccgcgagggctacaccctcgtcgacgtcgtggccctcgacccg
gcccaggagaactacgacgaggtgaagaccccgtcgcggcagaagttcctctcggagcac
cagcacgacgacgacgaggaccgctacttcgccaagggcgcgggcgtgttctacctgcac
gccaacgagaaggtgcacgcggtgtactgcgaggcgggcgacctcatctcggttccggcg
aacaccacgcactggttcgacatgggcaccgccccccactacgtgagcgtgcgcttcttc
cacgacgacgacggctgggtgggccacttcaccggcagtccgatcgccgagtcgttcgcg
accttcgaccagctcgccgagcgccgcgcgcagctggcctga

DBGET integrated database retrieval system