KEGG   Microbacterium testaceum: MTES_2014Help
Entry
MTES_2014         CDS       T01423                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_2014
   01230 Biosynthesis of amino acids
    MTES_2014
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_2014
   00051 Fructose and mannose metabolism
    MTES_2014
   00562 Inositol phosphate metabolism
    MTES_2014
Enzymes [BR:mts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTES_2014
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTES_2014
  Exosomal proteins of bladder cancer cells
   MTES_2014
  Exosomal proteins of melanoma cells
   MTES_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2159833..2160600)
Genome map
AA seq 255 aa AA seqDB search
MTAPVWVGVSLKTYFGHSRALAWLREVAGVVRDTPAVASGAVRLVVVPTYLQIPAALEAF
AGTGVLIGAQDVSAHPGGAFTGEIAASELAEIGVSYAEIGHAERRRLFGETDADTAAKAT
AALAAGLTPLLCLGETERTASDVAAATVVAQLHADLEGAPAGAVTVAYEPVWAIGAESPA
SIPHIVRVTRALREALDALPERTGSAVVYGGSAGPGLLTDLDGAVDGLFLGRFAHDPAQL
RRVIDEAAARAAVSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccggtatgggtgggagtgagcctgaagacgtacttcgggcactcccgcgct
ctcgcgtggctgcgcgaggtcgccggggtcgtccgcgacactccggccgtcgcctccggc
gccgtgcggctcgtcgtcgtccccacctatctgcagatccccgcggcactcgaggccttc
gccgggacgggcgtgctgatcggcgcacaggatgtctcggcccacccgggcggggccttc
accggtgagatcgcggcgtcggagctcgcggagatcggcgtctcctatgcggagatcggc
catgccgagcgccgacgcctcttcggcgagaccgatgccgacacggcggcgaaagccacg
gcggccttggcggcgggtctcacccctctgctgtgtctgggggagaccgagagaaccgcg
tccgacgtcgctgccgcgaccgtcgtggcgcagctgcacgcggatctcgagggcgccccc
gccggtgcggtcaccgtcgcctacgagccggtgtgggcgatcggcgcggagtctccggca
tccattccgcacatcgtccgcgtcacgcgggcgctccgcgaggctctcgacgcgctgccc
gaacgcacgggcagcgcggtggtctacggcggctcggcggggcccggccttctcaccgac
ctggacggcgcggtcgacggcctgttcctggggcgcttcgcccacgatcccgcacagctt
cgacgagtcatcgacgaggccgccgctcgcgcggcggtgagcgcatga

DBGET integrated database retrieval system