KEGG   Microbacterium testaceum: MTES_2021Help
Entry
MTES_2021         CDS       T01423                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mts  Microbacterium testaceum
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mts00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mts00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2167567..2169756
Genome map
AA seq 729 aa AA seqDB search
MTTQVISELSGAVDAPWDSVVALRAGGVSLILGLPDDALPFVIHWGADAGALDAKELREL
ATHALPPLATNGVDSSVVASVLPENSRGWTGTTGLAGHRSGKAWSTRFVPVAVEVAEQDG
QGGSVAVRAIDVDADLTLDLSIALLPSGLARLSAALTNTGESTYTLDGLQLALPVPTRAD
VLFDLAGRWGKEKVPQWREFTVGTHLREGRHGRTGADAATILTAGTADLDFGQGEAWGLH
VAFSGNHRTLAERAFSGERLLLGGELLLPGEIQLGPGEGYATPDVFAAYGAGLDDVAARF
HSYLRARPGHPRTVRPVVMNVWEAVYFDHDLTRLLELADAAQRVGVERFVLDDGWFGSRR
DDTSGLGDWIIAEDVWGGGRFRALVDGVKQRGMQFGLWFEPEMVNVASELAASHPEWLLQ
VPGRLPIEFRHQQVLDLSHPGAFAHVERQIVSLVREYGIDYIKWDHNRDLMDAGSTRTGR
AGVHEQTLATYRLLDAIRAACPGLEIESCSSGGARVDLEILNHTDRVWASDCIDARERQQ
IQRWTAQLLPPELVGSHVGAERAHTTRRQFDLDFRAATALFGHFGIEWDLTAASPEDLAR
LAEWVDYYKAVRSLIHTGTIIRRTLESGDLWLHGSVSPDRGRALYALTLRERHVTWPAGR
VQLPGLNPLAQYRVTVAGPGADAPYDPRVHPSWYRTGTVLAGSALSEVGLHIPALDPDTT
VLLDVEALA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgaccactcaggtgatttccgagctctccggtgcggtcgacgccccgtgggactccgtc
gtcgcacttcgggccggtggggtgtccctcattctcggcctccccgacgacgccctccct
ttcgtcatccactggggtgcggatgcgggtgccctggatgccaaagagctccgcgagctc
gccacccacgcgttgccgcccctcgcgaccaacggtgtcgacagcagcgtcgtcgcctcg
gtgctgcccgagaactcccgcggatggaccggaacgaccggcctggccgggcaccgttcg
ggaaaggcctggtcgacgaggttcgttccggtcgccgtcgaggtcgccgagcaggacggg
cagggcgggtccgtcgcggtccgcgcgatcgatgtcgacgccgacctcaccctcgacctg
tcgatagccctccttccgagcgggctcgcccgcctctccgcggcgctcaccaacaccggc
gagagcacctacacgctcgacggactgcagctggccctgcccgtgccgacccgggcggac
gtcctgttcgacctggccgggcgctggggcaaggagaaggtcccccagtggcgcgagttc
acggtgggcacgcacctgcgcgaggggcgtcacggacgcaccggagcggatgcggcgacg
atcctgaccgcgggaacggccgatctcgacttcggtcagggcgaggcgtggggcctgcac
gtcgccttcagcggaaaccaccgcacgctcgccgaacgggcgttctccggcgagcgcctt
ctgctcggcggagaactcctcctccccggcgagatccagctcggccccggggagggctac
gcgacgcccgacgtcttcgccgcgtacggcgccggcctggacgacgtggccgcgcggttc
cactcgtacctccgcgcccggcccggccacccccgcaccgtgcgccccgtcgtgatgaac
gtctgggaggccgtctacttcgaccacgacctgacccggctcctcgaactcgcggatgcc
gcgcagcgcgtcggtgtcgagcggttcgtcctggacgacgggtggttcggatcccgccgc
gacgacacctcgggcctgggggactggatcatcgccgaggacgtctggggaggggggcga
ttccgtgccctcgtcgacggcgtgaagcagcgggggatgcagttcggcctgtggttcgag
cccgagatggtgaacgtggcgtcggaactcgcggcatcccatcccgaatggctgctgcag
gtacccggtcgcctgcccatcgagttccgccaccagcaggtgctcgacctgtcgcacccg
ggcgcgttcgcgcacgtcgagcggcagatcgtctcccttgtgcgggagtacggcatcgac
tacatcaagtgggaccacaaccgggacctgatggatgccggctccacgcgcaccgggcgg
gcgggcgtgcacgagcagactctcgcgacgtaccgactcctcgacgcgatccgcgcggcc
tgtccggggctggagatcgagtcctgctcctcgggcggtgcccgcgtcgacctggagatc
ctgaaccacaccgaccgcgtgtgggcgtccgactgcatcgatgcgcgtgagcgccagcag
atccagcgctggacggcccagctgctgcccccggagctcgtgggaagccatgtcggtgcc
gaacgagcgcacaccacccggcgccagttcgacctggacttccgggcggccacggcgctg
ttcggacacttcggaatcgagtgggatctcaccgccgcctctcccgaggatctcgcccgt
ctcgcggagtgggtcgactactacaaagccgtgcggtcgctgatccacaccggcacgatc
atccggcgcacgctggagagcggcgacctgtggctgcacggcagcgtcagcccggatcgg
ggacgagccctgtacgccctgaccctccgggaacggcacgtgacgtggccggccggacgc
gtgcagttgcccggtctgaaccccctcgcgcagtaccgggtcacggtcgccggccccggt
gccgacgccccctacgacccccgggtccatccttcctggtaccgcaccggcaccgtcctc
gcgggatccgcgctcagcgaggtgggactgcacatccccgccctcgaccccgacaccacc
gttctcctcgacgtggaggctctcgcgtga

DBGET integrated database retrieval system