KEGG   Microbacterium testaceum: MTES_2021Help
Entry
MTES_2021         CDS       T01423                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mts  Microbacterium testaceum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MTES_2021
  Lipid metabolism
   00561 Glycerolipid metabolism
    MTES_2021
   00600 Sphingolipid metabolism
    MTES_2021
Enzymes [BR:mts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MTES_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2167567..2169756
Genome map
AA seq 729 aa AA seqDB search
MTTQVISELSGAVDAPWDSVVALRAGGVSLILGLPDDALPFVIHWGADAGALDAKELREL
ATHALPPLATNGVDSSVVASVLPENSRGWTGTTGLAGHRSGKAWSTRFVPVAVEVAEQDG
QGGSVAVRAIDVDADLTLDLSIALLPSGLARLSAALTNTGESTYTLDGLQLALPVPTRAD
VLFDLAGRWGKEKVPQWREFTVGTHLREGRHGRTGADAATILTAGTADLDFGQGEAWGLH
VAFSGNHRTLAERAFSGERLLLGGELLLPGEIQLGPGEGYATPDVFAAYGAGLDDVAARF
HSYLRARPGHPRTVRPVVMNVWEAVYFDHDLTRLLELADAAQRVGVERFVLDDGWFGSRR
DDTSGLGDWIIAEDVWGGGRFRALVDGVKQRGMQFGLWFEPEMVNVASELAASHPEWLLQ
VPGRLPIEFRHQQVLDLSHPGAFAHVERQIVSLVREYGIDYIKWDHNRDLMDAGSTRTGR
AGVHEQTLATYRLLDAIRAACPGLEIESCSSGGARVDLEILNHTDRVWASDCIDARERQQ
IQRWTAQLLPPELVGSHVGAERAHTTRRQFDLDFRAATALFGHFGIEWDLTAASPEDLAR
LAEWVDYYKAVRSLIHTGTIIRRTLESGDLWLHGSVSPDRGRALYALTLRERHVTWPAGR
VQLPGLNPLAQYRVTVAGPGADAPYDPRVHPSWYRTGTVLAGSALSEVGLHIPALDPDTT
VLLDVEALA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgaccactcaggtgatttccgagctctccggtgcggtcgacgccccgtgggactccgtc
gtcgcacttcgggccggtggggtgtccctcattctcggcctccccgacgacgccctccct
ttcgtcatccactggggtgcggatgcgggtgccctggatgccaaagagctccgcgagctc
gccacccacgcgttgccgcccctcgcgaccaacggtgtcgacagcagcgtcgtcgcctcg
gtgctgcccgagaactcccgcggatggaccggaacgaccggcctggccgggcaccgttcg
ggaaaggcctggtcgacgaggttcgttccggtcgccgtcgaggtcgccgagcaggacggg
cagggcgggtccgtcgcggtccgcgcgatcgatgtcgacgccgacctcaccctcgacctg
tcgatagccctccttccgagcgggctcgcccgcctctccgcggcgctcaccaacaccggc
gagagcacctacacgctcgacggactgcagctggccctgcccgtgccgacccgggcggac
gtcctgttcgacctggccgggcgctggggcaaggagaaggtcccccagtggcgcgagttc
acggtgggcacgcacctgcgcgaggggcgtcacggacgcaccggagcggatgcggcgacg
atcctgaccgcgggaacggccgatctcgacttcggtcagggcgaggcgtggggcctgcac
gtcgccttcagcggaaaccaccgcacgctcgccgaacgggcgttctccggcgagcgcctt
ctgctcggcggagaactcctcctccccggcgagatccagctcggccccggggagggctac
gcgacgcccgacgtcttcgccgcgtacggcgccggcctggacgacgtggccgcgcggttc
cactcgtacctccgcgcccggcccggccacccccgcaccgtgcgccccgtcgtgatgaac
gtctgggaggccgtctacttcgaccacgacctgacccggctcctcgaactcgcggatgcc
gcgcagcgcgtcggtgtcgagcggttcgtcctggacgacgggtggttcggatcccgccgc
gacgacacctcgggcctgggggactggatcatcgccgaggacgtctggggaggggggcga
ttccgtgccctcgtcgacggcgtgaagcagcgggggatgcagttcggcctgtggttcgag
cccgagatggtgaacgtggcgtcggaactcgcggcatcccatcccgaatggctgctgcag
gtacccggtcgcctgcccatcgagttccgccaccagcaggtgctcgacctgtcgcacccg
ggcgcgttcgcgcacgtcgagcggcagatcgtctcccttgtgcgggagtacggcatcgac
tacatcaagtgggaccacaaccgggacctgatggatgccggctccacgcgcaccgggcgg
gcgggcgtgcacgagcagactctcgcgacgtaccgactcctcgacgcgatccgcgcggcc
tgtccggggctggagatcgagtcctgctcctcgggcggtgcccgcgtcgacctggagatc
ctgaaccacaccgaccgcgtgtgggcgtccgactgcatcgatgcgcgtgagcgccagcag
atccagcgctggacggcccagctgctgcccccggagctcgtgggaagccatgtcggtgcc
gaacgagcgcacaccacccggcgccagttcgacctggacttccgggcggccacggcgctg
ttcggacacttcggaatcgagtgggatctcaccgccgcctctcccgaggatctcgcccgt
ctcgcggagtgggtcgactactacaaagccgtgcggtcgctgatccacaccggcacgatc
atccggcgcacgctggagagcggcgacctgtggctgcacggcagcgtcagcccggatcgg
ggacgagccctgtacgccctgaccctccgggaacggcacgtgacgtggccggccggacgc
gtgcagttgcccggtctgaaccccctcgcgcagtaccgggtcacggtcgccggccccggt
gccgacgccccctacgacccccgggtccatccttcctggtaccgcaccggcaccgtcctc
gcgggatccgcgctcagcgaggtgggactgcacatccccgccctcgaccccgacaccacc
gttctcctcgacgtggaggctctcgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system