KEGG   Microbacterium testaceum: MTES_2060Help
Entry
MTES_2060         CDS       T01423                                 

Definition
transcriptional regulator/sugar kinase
Organism
mts  Microbacterium testaceum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2219741..2220922
Genome map
AA seq 393 aa AA seqDB search
MTTESPQVASGVSELFQLLRDGVPRTRAELAKSTGLARSTVAVRVDELMRMGLITPVADA
VSTGGRPPSQFAINPAAKVVVAVDIGASHATVAIADLSGTILLEKSGALDIALGPEPVLS
WVVDGAHELLESAGRSPRDVAAMGIGVPGPVEHSTGLPVNPPIMPGWDRFDIPGWIAGHL
PVPVLVDNDVNVMALGERSVAWPGVDHFLFVKVATGIGAGLIAGGQLQRGAQGTAGDIGH
VQLARASAVACRCGNRGCLEALASGPAIARVLREEGIDAQSGDDVVDLVKRGNVDAIQAV
RQAGRDIGDVLTTCVSFINPSVIAIGGSMARVGEHLIAGVREVVYTRSTPLATEHLSIVP
SVAAEKAGVIGASMLAVEHVLSPESLTTGFLPA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgagtccccgcaggtcgcgagcggcgtcagcgagctgttccagctgctgcgc
gacggcgtgccgcgcacgcgggcggagctggcgaagtccaccgggctcgcgcgctcgacc
gtcgccgtccgcgtcgacgagctcatgcggatgggcctcatcaccccggtcgccgacgcg
gtgtcgaccgggggccggccgccgtcgcagttcgcgatcaacccggcggcgaaggtcgtg
gtcgcggtcgacatcggagcctcgcacgcgacggtcgcgatcgccgacctctcgggcacg
atcctgctcgagaagagcggggcgctcgacatcgcgctcggccccgaaccggtgctgagc
tgggtcgtcgacggagcgcacgagctgctcgagagcgcggggcgctcgccgcgcgacgtc
gccgcgatgggcatcggcgtgccgggtccggtcgagcactccaccggtctcccggtcaat
ccgccgatcatgcccggctgggatcggttcgacatccccgggtggatcgccgggcacctc
cccgtgccggtcctggtcgacaacgacgtcaatgtcatggcgctcggtgagcgcagcgtc
gcctggccgggcgtcgaccacttcctcttcgtcaaggtcgcgaccggaatcggcgccggt
ctcatcgcgggcggccagctccagcgcggagcgcagggcaccgccggcgacatcggtcac
gtgcaattggcccgcgcctcggcggtggcctgccgctgcggaaaccggggatgcctcgaa
gccctggcatccggtcccgctatcgcccgcgtgcttcgggaggaggggatcgacgcgcag
agcggcgacgacgtcgtcgacctcgtcaagcgcgggaacgtcgacgcgatccaggccgtg
cgtcaggcgggtcgcgacatcggcgacgtgctgacgacgtgcgtgagcttcatcaacccc
tccgtgatcgcgatcggcggctcgatggcccgggtgggggagcacctcatcgcgggagtg
cgcgaggtcgtgtacacccgctccacgccgctcgcgacggagcacctgtcgatcgtgccg
tccgtcgcggccgagaaggcgggcgtgatcggggcgagcatgctcgccgtcgagcacgtg
ctgtcgccggagtcgctgacgacgggcttcctccccgcctga

DBGET integrated database retrieval system