KEGG   Microbacterium testaceum: MTES_2203Help
Entry
MTES_2203         CDS       T01423                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mts  Microbacterium testaceum
Pathway
mts00480  Glutathione metabolism
mts00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MTES_2203
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MTES_2203
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MTES_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: BAJ75167
UniProt: E8NF94
Position
2401173..2401658
Genome map
AA seq 161 aa AA seqDB search
MDLSGIPITTIRGEQTTFGDLTDGKAALVVNVASRCGLAGQYETLEALHKRYADRGFTVI
GFPSNQFLQELSDEDKIAEYCSATWGVTFPMSEKVKLNGRNAHPLYKELTSTPDAEGKTG
RISWNFEKFVVAPDGRVTRFSPRTLPDAPEVVAAIEDALPR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggacctttccggcatcccgatcacgaccatccgcggcgagcagacgactttcggtgac
ctcaccgacggaaaggccgccctcgtcgtcaatgtcgcgtcgcgctgcggcctcgcgggg
cagtacgagacgctcgaggcgctgcacaagcgctacgcggaccgtgggttcacggtcatc
ggcttccccagcaaccagttcctccaggagctcagcgatgaggacaagatcgcggagtac
tgctcggcgacgtggggcgtgaccttcccgatgtcggagaaggtgaagctcaacgggcgc
aacgcgcacccgctgtacaaggagctcacctcgactccggatgccgagggcaagacgggc
cgcatctcgtggaacttcgagaagttcgtcgtcgcccccgacggtcgcgtgacccgcttc
agcccgcggacgctccccgacgcccccgaggtcgtcgcggcgatcgaggacgcgctgccg
cgctga

DBGET integrated database retrieval system