KEGG   Microbacterium testaceum: MTES_2203Help
Entry
MTES_2203         CDS       T01423                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mts  Microbacterium testaceum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MTES_2203
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MTES_2203
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MTES_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2401173..2401658
Genome map
AA seq 161 aa AA seqDB search
MDLSGIPITTIRGEQTTFGDLTDGKAALVVNVASRCGLAGQYETLEALHKRYADRGFTVI
GFPSNQFLQELSDEDKIAEYCSATWGVTFPMSEKVKLNGRNAHPLYKELTSTPDAEGKTG
RISWNFEKFVVAPDGRVTRFSPRTLPDAPEVVAAIEDALPR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggacctttccggcatcccgatcacgaccatccgcggcgagcagacgactttcggtgac
ctcaccgacggaaaggccgccctcgtcgtcaatgtcgcgtcgcgctgcggcctcgcgggg
cagtacgagacgctcgaggcgctgcacaagcgctacgcggaccgtgggttcacggtcatc
ggcttccccagcaaccagttcctccaggagctcagcgatgaggacaagatcgcggagtac
tgctcggcgacgtggggcgtgaccttcccgatgtcggagaaggtgaagctcaacgggcgc
aacgcgcacccgctgtacaaggagctcacctcgactccggatgccgagggcaagacgggc
cgcatctcgtggaacttcgagaagttcgtcgtcgcccccgacggtcgcgtgacccgcttc
agcccgcggacgctccccgacgcccccgaggtcgtcgcggcgatcgaggacgcgctgccg
cgctga

DBGET integrated database retrieval system