KEGG   Microbacterium testaceum: MTES_2433Help
Entry
MTES_2433         CDS       T01423                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mts  Microbacterium testaceum
Pathway
mts00620  Pyruvate metabolism
mts00630  Glyoxylate and dicarboxylate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTES_2433 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MTES_2433 (aceB)
Enzymes [BR:mts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MTES_2433 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAJ75397
UniProt: E8NGU8
Position
complement(2633621..2635234)
Genome map
AA seq 537 aa AA seqDB search
MPNPSASTPHLRLERPLEGRDAEILTPAAIAFLTELHDRFARRRHDRLAARERRRFEIGT
GDDPHFRADTAHIRDDPSWRVAGAGPGLEDRRVEITGPTDPKMTINALNSGARVWLADQE
DATSPTWRNVIGGQLSLFDAIRGQLSFTSPEGKRYEVTAERTPTIVMRPRGWHLPEKHVT
FIDRSGRELPASGSLVDYGLYVFHNAHALIAAGRGPYFYLPKIESAEEARLWDDVFSFTE
ERLGLAHGTIRATVLIETLPAAFEMEEILFALRDHCAGLNAGRWDYIFSIIKTYRGRGAR
FVLPDRSEVTMTVPFMRAYTELLVQTCHKRGAYAIGGMSAFIPNRRKPEVTAAAFEKVAA
DKRREAGDGFDGTWVAHPDLIPVARAEFDAVLGDAPNQLERTREDVSVEPHRLLDLRIGL
PVTTAGVRGNVSVAIRYIEAWLRGLGAVAIDDLMEDAATAEISRSQIWQWIHQDRVTAEG
DTITRPFVEGLLDEVLSEVPRSEGDRFDDAAAVFREVALRPEFPAFLTLPAYAKYLD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacccctcggcatccaccccccacctgcgtctcgagcgccccctcgagggacgg
gatgccgagatcctcacccccgcggcgatcgcgttcctcaccgagctgcacgaccgtttc
gcccgacgccggcacgaccggctcgccgcccgcgagcgccgccgcttcgagatcggcacg
ggcgacgacccgcacttccgagccgacaccgcgcacatccgcgacgacccgtcgtggcgc
gtggcgggagccggccccggcctggaggaccgccgcgtcgagatcaccggcccgaccgac
ccgaagatgacgatcaacgcgctgaactccggcgcgcgggtgtggctcgccgaccaggag
gatgccacctcccccacctggcgcaacgtcatcggcgggcagctctcgctgttcgacgcg
atccgcgggcagctgtcgttcacgagccccgagggaaagcgctacgaggtcaccgccgag
cgcaccccgacgatcgtgatgcgcccgcgcggctggcacctgcccgagaagcacgtgacg
ttcatcgatcgctccggccgtgagctgccggcatccgggtccctcgtcgactacgggctg
tacgtcttccacaacgcgcacgcgctgatcgccgcgggccgcgggccgtacttctaccta
ccgaagatcgagtcggccgaagaggcgcggctgtgggacgacgtgttctcgttcaccgag
gagcggctcggcctcgcgcacggcacgatccgtgcgacggtgctcatcgagacgctgccc
gcggcgttcgagatggaggagatcctgttcgccctgcgcgaccactgcgcgggcctgaac
gccgggcgctgggactacatcttctcgatcatcaagacctaccgcgggcgcggagcgcgg
ttcgtgctccccgaccgcagcgaggtcacgatgacagtgccgttcatgcgcgcctacacc
gaactgctcgtgcagacgtgccacaagcgcggcgcctatgcgatcggcggcatgagcgcc
ttcatccccaaccggcgcaagcccgaggtgaccgcagcggcgttcgagaaggtcgccgcc
gacaagcggcgcgaggccggcgacggcttcgacggcacgtgggtcgcccaccccgacctc
atcccggtggcccgtgccgagttcgacgcggtgctcggcgacgcgccgaatcagctcgag
cggacgcgtgaggacgtgtccgtcgagccgcaccggctgctcgacctgcgcatcggcctg
cccgtgaccacggcgggcgtgcgcggcaacgtctcggtggcgatccgctacatcgaggcg
tggctgcggggcctcggcgcggtcgcgatcgacgacctcatggaggacgccgccaccgcc
gagatctcgcgctcgcagatctggcagtggatccaccaggatcgcgtcaccgccgagggc
gacacgatcacgcgtccgttcgtcgaggggctgctcgacgaggtgctgtccgaggtgccg
cgctccgagggcgaccgcttcgacgacgccgccgcggtgttccgcgaggtggcgctgcgt
ccggagttcccggccttcctgaccctgccggcgtacgcgaagtacctcgactga

DBGET integrated database retrieval system