KEGG   Microbacterium testaceum: MTES_2434Help
Entry
MTES_2434         CDS       T01423                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mts  Microbacterium testaceum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mts01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mts00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2635531..2636847)
Genome map
AA seq 438 aa AA seqDB search
MTIQATPAQPPLRPGDQTETAAELRAAWDADPRWDGIERTFSADDVVRLRGSVREEATLA
RRGAENLWNLLHTEEYVRALGAYTGGQAVQQVRAGLKAIYLSGWQVAADGNLAGQTYPDQ
SLYPANSVPAVVRRINNALLRQDQIERAEGEITRDWLAPIVADAEAGFGGPLNAYELAQS
LIQAGAAGIHWEDQLASEKKCGHLGGKVLVPIQQHIRTLNASRLAADVAGVPTVIIARTD
ALAADLLTSDVDERDAEFLTGERTSEGFYRVRPGLDSVIARGLAFAPYADLLWVETGEPD
IELARRFAEAIHARFPGKKLAYNCSPSFNWKRHLDDAQIATFQAELAAMGYAFQFITLAG
FHAVNHSMFDLARGYAERAMSAYVELQEAEFAAEANGYTATRHQREAGTGYFDVVSTALN
PDSATLALAGSTETAQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccaggccacccccgcgcagccgccgctccgccccggcgaccagaccgagacc
gccgccgagctccgtgccgcttgggatgccgacccccgctgggacggcatcgagcgcacg
ttctcggccgacgacgtcgtccgcctccgtggcagcgtccgcgaagaggcgacgctcgcc
cgtcgcggagccgagaacctctggaatctcctgcacaccgaggagtacgtccgcgcgctc
ggtgcctacaccggcggccaggccgtgcagcaggtgcgcgccggcctgaaggccatctac
ctctccgggtggcaggtcgccgccgacggcaacctggcggggcagacctaccccgaccag
agtctctacccggccaacagtgtccccgccgtcgtccgccgcatcaacaacgccctgctg
cggcaggaccagatcgagcgcgccgagggagagatcacccgggactggctcgccccgatc
gtcgccgacgccgaggccggtttcggcggtccgctgaacgcctacgagctcgcgcagtcg
ctgatccaggccggagccgccggcatccactgggaagaccagctcgcgagcgagaagaag
tgcggtcacctcggcggcaaggtgctcgtgccgatccagcagcacatccgcaccctcaac
gcctcacgtctggcggcagatgtcgccggcgttccgacggtaatcatcgcccgcaccgat
gccctcgccgccgacctgctcacgagcgacgtcgacgagcgggacgctgagttcctcacc
ggcgagcgcaccagcgagggcttctaccgggtgcgcccgggactcgactcggtgatcgcg
cgcggtctcgccttcgccccgtacgccgacctgctgtgggtcgagaccggtgagcccgac
atcgagctcgcgcgccgcttcgccgaggcgatccacgcccgcttcccgggcaagaagctc
gcgtacaactgctcaccgagcttcaactggaagcgccacctcgacgacgcgcagatcgcg
acgttccaggccgagctcgcggcgatgggctacgccttccagttcatcaccctggccggc
ttccacgccgtgaaccactcgatgttcgacctcgcccgcggctacgccgagcgcgccatg
agcgcgtacgtcgagctgcaggaggccgagttcgccgccgaagcaaacgggtacaccgcc
acgcgccaccagcgcgaagcgggcaccggctacttcgacgtcgtctccaccgcgctcaac
cccgacagcgcaactctggccctggccggctcgaccgagaccgcccagttccactga

DBGET integrated database retrieval system