KEGG   Microbacterium testaceum: MTES_2434Help
Entry
MTES_2434         CDS       T01423                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00630  Glyoxylate and dicarboxylate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTES_2434
Enzymes [BR:mts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MTES_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAJ75398
UniProt: E8NGU9
Position
complement(2635531..2636847)
Genome map
AA seq 438 aa AA seqDB search
MTIQATPAQPPLRPGDQTETAAELRAAWDADPRWDGIERTFSADDVVRLRGSVREEATLA
RRGAENLWNLLHTEEYVRALGAYTGGQAVQQVRAGLKAIYLSGWQVAADGNLAGQTYPDQ
SLYPANSVPAVVRRINNALLRQDQIERAEGEITRDWLAPIVADAEAGFGGPLNAYELAQS
LIQAGAAGIHWEDQLASEKKCGHLGGKVLVPIQQHIRTLNASRLAADVAGVPTVIIARTD
ALAADLLTSDVDERDAEFLTGERTSEGFYRVRPGLDSVIARGLAFAPYADLLWVETGEPD
IELARRFAEAIHARFPGKKLAYNCSPSFNWKRHLDDAQIATFQAELAAMGYAFQFITLAG
FHAVNHSMFDLARGYAERAMSAYVELQEAEFAAEANGYTATRHQREAGTGYFDVVSTALN
PDSATLALAGSTETAQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccaggccacccccgcgcagccgccgctccgccccggcgaccagaccgagacc
gccgccgagctccgtgccgcttgggatgccgacccccgctgggacggcatcgagcgcacg
ttctcggccgacgacgtcgtccgcctccgtggcagcgtccgcgaagaggcgacgctcgcc
cgtcgcggagccgagaacctctggaatctcctgcacaccgaggagtacgtccgcgcgctc
ggtgcctacaccggcggccaggccgtgcagcaggtgcgcgccggcctgaaggccatctac
ctctccgggtggcaggtcgccgccgacggcaacctggcggggcagacctaccccgaccag
agtctctacccggccaacagtgtccccgccgtcgtccgccgcatcaacaacgccctgctg
cggcaggaccagatcgagcgcgccgagggagagatcacccgggactggctcgccccgatc
gtcgccgacgccgaggccggtttcggcggtccgctgaacgcctacgagctcgcgcagtcg
ctgatccaggccggagccgccggcatccactgggaagaccagctcgcgagcgagaagaag
tgcggtcacctcggcggcaaggtgctcgtgccgatccagcagcacatccgcaccctcaac
gcctcacgtctggcggcagatgtcgccggcgttccgacggtaatcatcgcccgcaccgat
gccctcgccgccgacctgctcacgagcgacgtcgacgagcgggacgctgagttcctcacc
ggcgagcgcaccagcgagggcttctaccgggtgcgcccgggactcgactcggtgatcgcg
cgcggtctcgccttcgccccgtacgccgacctgctgtgggtcgagaccggtgagcccgac
atcgagctcgcgcgccgcttcgccgaggcgatccacgcccgcttcccgggcaagaagctc
gcgtacaactgctcaccgagcttcaactggaagcgccacctcgacgacgcgcagatcgcg
acgttccaggccgagctcgcggcgatgggctacgccttccagttcatcaccctggccggc
ttccacgccgtgaaccactcgatgttcgacctcgcccgcggctacgccgagcgcgccatg
agcgcgtacgtcgagctgcaggaggccgagttcgccgccgaagcaaacgggtacaccgcc
acgcgccaccagcgcgaagcgggcaccggctacttcgacgtcgtctccaccgcgctcaac
cccgacagcgcaactctggccctggccggctcgaccgagaccgcccagttccactga

DBGET integrated database retrieval system