KEGG   Microbacterium testaceum: MTES_2602Help
Entry
MTES_2602         CDS       T01423                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_2602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_2602
   00052 Galactose metabolism
    MTES_2602
   00500 Starch and sucrose metabolism
    MTES_2602
   00520 Amino sugar and nucleotide sugar metabolism
    MTES_2602
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTES_2602
   00524 Butirosin and neomycin biosynthesis
    MTES_2602
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MTES_2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2810125..2811057
Genome map
AA seq 310 aa AA seqDB search
MSDATPSLPPYTHVLAVDIGGTKVDAAVVSIAGEVVRESVTRRPTGRESDRETLARNVRE
AAEAALAAVPDLSVGAVGVGSAGPVDLPSRTVSPLNLPLAAGLPVDEVLGGLVDGPLSLA
LDGTCIALAEHWRGALLGCRNALAIVVSTGVGGGFVLDGRPMGGASGNAGHLGQTFVRTI
HDGEVVASTLEAVAAGPGTVTWAQSQGWVGETGLDLAASYRAGDEIATAAVARSATAVGQ
AIAAAATLCDLEAVAIAGGFSQVADDYIDQVRVAAQAASVHEYARRCRITGSGLDGDGPL
LGAAALALRA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgccaccccgtccctgcccccctacacgcacgtcctcgccgtcgatatcggc
gggacgaaggtcgatgccgccgtcgtgtcgatcgccggcgaggtggtccgcgagagcgtg
acccgccgtcccaccggccgcgagagcgatcgcgagaccctcgcgcggaacgtgcgcgag
gccgcggaagcggcgctcgcggcggtgcccgacctctcggtgggggcggtcggcgtcggc
agcgccggaccggtcgacctgccctcgcgcaccgtctcgccgctgaacctcccgctggcg
gcgggtctcccggtcgacgaggtgctgggcggcctcgtcgacggtcccctctcgctcgct
ctcgacggcacgtgcatcgcgctcgccgaacactggcgcggcgccctgctcggatgccgg
aacgccctcgcgatcgtcgtctccaccggcgtcggcggcgggttcgtcctggacgggcgt
ccgatgggcggggcgagcggcaacgcgggccacctcgggcagacgttcgtgcgcacgatc
cacgacggcgaggtcgtggcatccacccttgaagccgtcgccgccggccccggcacggtg
acgtgggcgcagagccagggctgggtgggcgagaccgggctcgacctcgccgcgtcctac
cgcgcgggcgatgagatcgcgaccgccgccgtggcgcgctcggcgaccgcggtcggtcag
gcgatcgccgcggcggcgaccctctgcgacctcgaggccgtcgcgatcgccggcgggttc
tcgcaggtggccgacgactacatcgatcaggtgcgcgtggccgcgcaggcggcatccgtc
cacgagtacgcgcgccggtgccgcatcaccggctcgggtctcgacggcgacgggccgctc
ctgggggccgctgccctcgccctgcgcgcctga

DBGET integrated database retrieval system