KEGG   Microbacterium testaceum: MTES_2629Help
Entry
MTES_2629         CDS       T01423                                 

Gene name
recR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
mts  Microbacterium testaceum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MTES_2629 (recR)
DNA repair and recombination proteins [BR:mts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MTES_2629 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2845443..2846036
Genome map
AA seq 197 aa AA seqDB search
MYDGIVQDLIDEFGRLPGIGPKSAQRIAFHILQSPSFDVSRLSTLLGEIRDKVKFCEICG
NVTEQERCSICRDPRRNATLICVVEDAKDVAAIERTREFRGLYHVLGGAISPIAGIGPDD
LRVTQLMQRLADGTVQEVILATNPNLEGEATATYLSRLLHTLEIRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRTL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggcatcgtccaagacctgatcgatgagttcggccgtctcccgggaatcggt
ccgaagtcggcgcagcgcatcgcgttccacatcctgcagtccccgagcttcgacgtctcg
cggctgtcgaccctgctcggcgagatccgcgacaaggtgaagttctgcgagatctgcggc
aacgtcaccgaacaggaacgctgctcgatctgccgcgacccgcgccgcaacgccaccctc
atctgcgtcgtcgaagacgcgaaggacgtggcggcgatcgagcgcacgcgggagttccgc
ggcctctatcacgtgctcggcggcgccatcagccccatcgcgggcatcggccccgacgac
ctccgcgtcacgcagctcatgcagcggctcgccgacggcaccgtccaggaagtcatcctc
gcgacgaaccccaacctcgagggcgaggcgacggccacgtacctcagccgcttgctgcac
accctcgagatccgcgtcacgcgtctggcatccggtctccccgtcggcggagacctcgag
tacgcggacgaggtcacgctgggacgcgctttcgaaggccgccgtacgctctga

DBGET integrated database retrieval system