KEGG   Microbacterium testaceum: MTES_2681Help
Entry
MTES_2681         CDS       T01423                                 

Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mts  Microbacterium testaceum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MTES_2681
Enzymes [BR:mts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MTES_2681
    3.5.1.-  
     MTES_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2908911..2909489
Genome map
AA seq 192 aa AA seqDB search
MTRALFIVDVQNDFTEHGALGVAGGDAVAERISRYLAAHADEYAVIVASRDWHHGDDDNG
GHFSATPDFVDSWPVHCVAGTEGAEYDAVFDASRVTHHLKKGQGRPAYSLFEGVSDDGQT
AADILDAHGIRDIDIAGIATDYCVRASALDAVAAGREVRVFTDLVAGVHPDSSAAALAEI
ERAGATLVTSEV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaccagggcgctgttcatcgtggatgtccagaacgatttcaccgagcacggggctctc
ggagtcgccgggggcgacgccgtcgccgagcggatctcgcgttatctggccgcgcacgcc
gacgagtacgccgtgatcgtcgcctcccgcgactggcatcatggcgacgacgacaacggc
ggccatttctccgccactcccgacttcgtcgactcgtggcccgtgcactgcgtcgcgggt
accgagggggccgagtacgacgcggtgttcgatgcgagccgcgtgacgcaccacctcaag
aaggggcaggggcgtccggcctactcgctgttcgagggcgtctcggacgacgggcagacc
gcggccgacatcctcgacgcccacgggatccgcgacatcgacatcgcggggatcgcgacc
gactactgcgtgcgcgcgtccgccctcgatgcggtcgccgccggccgcgaggtccgcgtg
ttcaccgacctcgtcgcgggcgtgcaccccgattcgagtgcggcggccctggccgagatc
gagcgcgccggagcgacgctggtgacctcagaggtctag

DBGET integrated database retrieval system