KEGG   Microbacterium testaceum: MTES_2727Help
Entry
MTES_2727         CDS       T01423                                 

Gene name
gpmA
Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_2727 (gpmA)
   01230 Biosynthesis of amino acids
    MTES_2727 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_2727 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MTES_2727 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_2727 (gpmA)
Enzymes [BR:mts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MTES_2727 (gpmA)
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MTES_2727 (gpmA)
  Exosomal proteins of melanoma cells
   MTES_2727 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2961496..2962242
Genome map
AA seq 248 aa AA seqDB search
MPHTLILLRHGQSEWNKTNQFTGWVDVRLTDQGKAEAKRGGELLAESGILPDVLHTSVLS
RAIQTANIALDAADRLWIPVKRSWRLNERHYGALQGKDKAQTLEEFGNEQFMLWRRSFDV
PPPPLPADDQYSQVGDPRYVGINGEVPDTESLKIVIDRMLPYWHSDIVPDLQAGKTVLVT
AHGNSLRGLVKHLEGISDADIAELNIPTGIPLVYRLDDDLKPLGPGEYLDPEAAAAGAAA
VAAQGNKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacacgctgatcctcctccgccacgggcagagcgagtggaacaagaccaaccag
ttcaccggctgggtcgacgtgcgactcaccgaccagggcaaggccgaggcgaagcgcggc
ggcgagctgctcgccgagtccggcatcctgcctgacgtgctgcacacctcggtgctcagc
cgcgcgatccagacggcgaacatcgcgctcgacgcggccgaccgtctgtggatccccgtg
aagcgctcgtggcgcctcaacgagcgtcactacggcgctctgcagggcaaggacaaagcg
cagacgctcgaagagttcggtaacgagcagttcatgctctggcgccgttcgttcgacgtt
ccgccgccgccgctgcccgcggacgaccagtacagtcaggtcggtgacccccgctacgtc
ggcatcaacggcgaggttcccgacaccgagtcgctgaagatcgtcatcgaccgcatgctg
ccgtactggcacagcgacatcgtccccgacctgcaggcgggaaagaccgtgctcgtcacc
gcgcacggcaactcgctgcgcggcctcgtgaagcacctcgagggcatcagcgacgccgac
atcgcggagctgaacatccccacgggcatcccgctcgtctaccgcctcgacgacgacctc
aagcccctcggcccgggcgagtacctcgaccccgaggccgctgccgcgggggccgcggcc
gtggccgcgcagggcaacaagcactga

DBGET integrated database retrieval system