KEGG   Microbacterium testaceum: MTES_2805Help
Entry
MTES_2805         CDS       T01423                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mts  Microbacterium testaceum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTES_2805 (galU)
   00052 Galactose metabolism
    MTES_2805 (galU)
   00500 Starch and sucrose metabolism
    MTES_2805 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MTES_2805 (galU)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MTES_2805 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3036924..3037820
Genome map
AA seq 298 aa AA seqDB search
MPMPHKPFKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEATGAGIDDVLIII
GRNKNNIANHFDSMPELEAKLREKGDSDKLAKVEHSSDLADVHMVRQGEPKGLGHAVLRA
RSHVGDHPFAVLLGDDLIDERDPLLTKMMEEYDKRNATVIALMEVDPEHIHLYGVAAVEP
TDEDGVVKVTQLVEKPKAEDAPSNLAIIGRYVLGPDVFGILEHTEPGKGGEIQLTDALEE
LANGGGDGGGVYGVVFRGRRYDTGDRVDYIKAIVQLAADRDDLGPALRPWFKEFAAGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgcctcataagcccttcaaggccgtcattccggccgcaggactcggtacgcgc
ttcctcccggccaccaaggccatgccgaaggagatgttgccggtcgtcgacaagccggcc
atccagtacgtcgtcgaagaggccaccggcgccgggatcgacgatgtcctcatcatcatc
ggccgcaacaagaacaacatcgccaaccacttcgactcgatgcccgagctcgaggcgaag
ctccgcgagaagggcgacagcgacaagctcgccaaggtcgagcactcctccgacctcgcc
gacgtgcacatggtgcgtcagggcgagccgaagggtctcggccacgccgtgctccgcgcg
cgcagccacgtgggcgaccaccccttcgccgtcctcctcggcgacgacctcatcgacgag
cgcgacccgctgctcaccaagatgatggaggagtacgacaagcgcaatgccacggtcatc
gcgctgatggaggtcgaccccgagcacatccacctctacggggtcgcggccgtcgagccc
accgacgaagacggcgtggtcaaggtcacgcagctcgtcgagaagcccaaggccgaagac
gcgccttccaacctggccatcatcggtcggtacgtcctcgggcccgacgtgttcggcatc
ctggagcacaccgagcccggcaaggggggcgagatccagctgaccgacgcgctcgaggag
ctcgccaacggcggcggcgacggtgggggagtgtacggcgtggtcttccgcggccgtcgc
tacgacaccggcgaccgcgtcgactacatcaaggcgatcgttcagctcgccgccgaccgt
gacgacctgggcccggcgcttcgtccgtggttcaaggagttcgcggcgggtctctga

DBGET integrated database retrieval system