KEGG   Microbacterium testaceum: MTES_2874Help
Entry
MTES_2874         CDS       T01423                                 

Definition
sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mts  Microbacterium testaceum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MTES_2874
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MTES_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3119579..3120433)
Genome map
AA seq 284 aa AA seqDB search
MTVSPHSPAPRLTVVGAINVDLTARVERAPAAGETVADGVLQRGPGGKGANQAVAAARLG
AEVRLVGAVGDDLDGRGIREQLAAVGIDASGVQTADAATGTALIVVDATGENSIVVCAGA
NAAIDPDALGIEPGAAVLMQLEVSDAVVAAAAEAAGYLALNAAPARPLPAGVLERCDLVI
VNETEYAQLPEVHDAPLLCVTLGAEGARLYRHGQLVASAAGVATTVRNTVGAGDAFCAAL
VCGLLRGDDEADALARACAVGAAAVADDASQPALEPLDAYGVPA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgagcccccactcccccgcacctcgcctgaccgtcgtcggcgcgatcaacgtc
gacctgaccgcgcgcgtcgagcgcgcccccgccgccggggagaccgtcgccgacggcgtc
ctgcagcgcgggcccggggggaagggcgcgaatcaggcggtcgcggccgcgcgactcggc
gccgaggtacgactggtcggtgccgtgggagacgacctcgacgggcgtgggatccgcgag
cagctggccgcggtgggcatcgacgcgtccggcgtgcagacggcggatgccgcgacggga
accgcgctcatcgtcgtcgacgcgaccggcgagaactcgatcgtcgtgtgcgcgggcgcg
aacgcggcgatcgacccggatgcgctcggtatcgagcccggggccgcggtgctgatgcag
ttggaggtctcggatgccgtcgtcgcggccgccgcggaagccgcgggctatctcgcgctg
aacgccgccccggcgcggccgctgcccgcgggggtcctcgagcgttgcgacctcgtcatc
gtgaacgagaccgagtacgcgcagctccccgaggtgcacgatgccccgctcctgtgcgtg
acgctcggcgccgaaggtgcccgcctctaccgacacggccaactcgtcgcctcggccgcc
ggggtcgcgacgaccgtccgcaacaccgtcggggccggcgacgcgttctgcgccgctctc
gtgtgcgggctgctgcgcggcgacgacgaggccgacgccctcgcgcgcgcctgcgcggtg
ggagccgcggccgtcgccgacgacgcctcgcaacccgccctggaacccctcgacgcgtac
ggagtccccgcatga

DBGET integrated database retrieval system