KEGG   Microbacterium testaceum: MTES_2917Help
Entry
MTES_2917         CDS       T01423                                 

Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mts  Microbacterium testaceum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MTES_2917
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MTES_2917
Enzymes [BR:mts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MTES_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3166897..3168054)
Genome map
AA seq 385 aa AA seqDB search
MKTAARTSALLVLAALTLTGCVPEPAPTPSPTASPSPSPTPTPTPTPDPLAGMSLDDRVG
QLFMVGTSVDGADPTTLAAVTDDHIGGIFLHGRSDAGAQATAGLVSTFTSAQATGQPLLW
VSTDQEGGEVQVLSGPGFDEIPSAVDQGQQDDATLRGNAATWGGQLAQAGVNMNLAPVAD
VVTSPETAQSNPPIGQLDRQYGYDGATVAAKAGAFAAGMRDGGVLPTFKHFPGLGHVGDN
TDTTAGVTDDFVTADGADVGVYSTVLPEGPAVVMLSTAIYAKIDPSAPAAFSPTVVGVLR
NTVGFDGVVTTDDLSAAQQVQAWSPADRATLAIEAGIDLLLVSADSSVYPEMRDAVRSRA
QSDSAFAAKVDAAATRILSAKASMP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgccgcgcggacctccgccctgctcgtgctcgccgccctgacgctcaccggg
tgcgtccccgagcccgctccgaccccgagcccgacggcatccccgtccccctcaccgact
cccaccccgacacccaccccggatcctctggcggggatgagcctcgacgacagggtggga
cagctgttcatggtggggacctcggtcgacggggccgacccgacgaccctggcggcggtc
accgacgaccacatcggcgggatcttcctgcacggacgatcggatgccggggctcaggcg
accgcgggactcgtgtcgacgttcacctcggcgcaggcgacggggcagccgctgctctgg
gtgtccaccgatcaggagggcggcgaggtgcaggtgctgagcggcccggggttcgatgag
atcccctccgccgtcgaccaggggcagcaggacgacgcgaccctccgcggcaacgcggcg
acctggggcgggcaactcgcccaggccggcgtcaacatgaacctcgctcccgtggccgac
gtcgtcacgagccccgagacggcgcagagcaacccgccgatcggccagctcgaccgccag
tacggctacgacggagcgaccgtggccgccaaggcgggggcattcgccgccggaatgcgc
gacggtggggtgctcccgaccttcaagcacttccccggcctcgggcacgtcggcgacaac
accgacacgaccgccggggtgaccgacgacttcgtcacggccgacggcgccgacgtgggc
gtgtactcgacggtgctgccggaggggccggcggtggtcatgctgtcgacggcgatctac
gccaagatcgatccctcggcgcccgcggccttctcacccacggtcgtcggggttctgcgg
aacacggtcggcttcgacggcgtcgtgaccacggacgacctctccgccgcgcagcaggtg
caggcctggtcgccggccgatcgcgccaccctcgccatcgaggcggggatcgacctgctc
ctggtgtcggcggattcgtcggtgtaccccgagatgcgcgacgcggtccgctcgcgcgcg
cagagcgacagcgccttcgccgcgaaggtggatgccgcggcgacccgcatcctgtcggcg
aaggcgtcgatgccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system