KEGG   Microbacterium testaceum: MTES_3232Help
Entry
MTES_3232         CDS       T01423                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mts  Microbacterium testaceum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mts00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mts00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3503672..3505045
Genome map
AA seq 457 aa AA seqDB search
MSTLVTDTGDQNPGQPDWEAAETLTIRGGRPLRGTVEVKGAKNLVTKAMVAALLGDSTST
LRDVPMISDVKVVRSLLEVHGVTVTEGEEEGTLHLDPSGAVAAHFEEIDAHAGASRIPIL
FCGPLLHLLGEALIPDLGGCRIGDRPINFHMDALRAFGAVVDKSYEGIRITAPNGLHGAN
ITLPYPSVGATEQVLLTAVRAKGVTELRNAAIEPEIMDLIAVLQKMGAIISYEPNRVIFI
EGVDKLDGYDHRAIFDRNEAASWACAALATDGEIFAKGARQQDMLTFLNVFRKAGGWFDV
REDGILFRRGEALKPVMVETDVHPGFMTDWQQPLIVALTQAPGTSTVHETVYENRLGFTA
ALNKMGADIVVHPKGIASPDRRVPRRDLEQAAVINGPTPLHGADVEVPDLRGGYSYVIAA
LAAEGESTVRNIGIIRRGYEKFLEKLTALDADFSVVG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactcgtcaccgataccggagaccagaaccccggccagccggactgggaggcg
gcagagaccctcaccatccgcggcggtcgccccttgcgcggcaccgtcgaggtcaaggga
gcgaagaacctcgtcaccaaggcgatggtggcggcccttctgggcgacagcaccagcacc
ctgcgcgacgtcccgatgatcagcgacgtcaaggtcgtccgttcgctcctcgaggtgcac
ggcgtcaccgtcaccgagggcgaggaggagggaaccctccacctcgacccctccggcgcg
gtcgccgcgcacttcgaggagatcgacgcgcacgcgggcgcttcgcgcatcccgatcctc
ttctgcggcccgctgctgcacctgctcggtgaagcgctgatccccgacctcggcggatgc
cgcatcggcgaccgtccgatcaacttccacatggacgcgctccgcgccttcggtgcggtc
gtcgacaagagctacgagggcatccgcatcacggcgcccaacggcctgcacggggcgaac
atcacgctcccgtacccgagcgtcggcgcgaccgagcaggtgctgctcacggccgtccgc
gcaaagggcgtcaccgagctgcgcaacgccgcgatcgagcccgagatcatggacctgatc
gcggtgctgcagaagatgggcgcgatcatctcctacgagcccaaccgcgtcatcttcatc
gagggcgtcgacaagctcgacggctacgaccaccgcgcgatcttcgaccgcaacgaggcc
gcgtcgtgggcctgcgccgctctcgcgaccgacggtgagatcttcgccaagggcgcgcgt
cagcaggacatgctgaccttcctcaacgtcttccgcaaggccggcggctggttcgacgtc
cgcgaggacggcatcctgttccgtcggggcgaggcgctcaagcccgtcatggtcgagacc
gacgtgcaccccggcttcatgacggattggcagcagccgctgatcgtggcgctcacgcag
gctccggggacctcgacggtccacgagaccgtgtacgagaaccgcctcggcttcacggcc
gcgctgaacaagatgggcgcggacatcgtcgtgcacccgaagggcatcgcgagccccgac
cgccgtgtcccgcgtcgcgacctcgaacaggccgccgtcatcaacggtccgacgccgctg
cacggagccgacgtcgaggtccccgacctccgcggcggttacagctacgtgattgccgcc
ctggcggccgagggcgagtcgacggtgcgcaacatcggcatcatccgccgcgggtacgag
aagttcctcgagaagctcaccgctctcgacgccgatttctcggtcgtgggctga

DBGET integrated database retrieval system