KEGG   Microbacterium testaceum: MTES_3356Help
Entry
MTES_3356         CDS       T01423                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mts  Microbacterium testaceum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mts01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mts00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3632641..3633477
Genome map
AA seq 278 aa AA seqDB search
MTAATRADIPRASRVVVKVGSSSISGDGAHRIDTIVEALSRANAAGVEVVLVSSGAIATA
LPLLDLQGRPNDLATQQAAAAVGQNVLMWRYQTSLDRFGLLAGQVLLTAGDLENATSRSN
ARRAMERLLGLGILPIVNENDTVATHEIRFGDNDRLAALVAQLIGADALVLLSDIACLYT
APPNEPGARPITEVAWGDDLSDFEFGAGVVNGVGTGGAATKASAAKLASAAGVGVLVTSA
DLVADALAGESVGTWFVPNPDAVTLSTGPVGAVSATVD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgacggccgcgacccgcgccgacatcccccgcgcgtcccgcgtcgtcgtcaaggtcggc
tcctcgtcgatcagcggggacggggcgcaccgcatcgacacgatcgtcgaggctctctcg
cgcgcgaacgccgcaggtgtcgaggtcgtcctggtgtcctccggcgcgatcgcgacggct
cttccgttgctcgacctgcagggccgaccgaacgacctcgcgacccagcaggcggccgcc
gccgtcggccagaacgtcctcatgtggcgctaccagacctctctcgaccgcttcggcctg
ctcgccgggcaggtgctgctcacggccggcgatctcgagaacgccacgtcgcgctccaac
gcgcgccgggcgatggaacggctgctggggctcggcatcctgcccatcgtcaacgagaac
gacacggtggccacgcacgagatccgcttcggcgacaacgaccggctcgcggccctcgtc
gctcagctgatcggcgccgacgcgctcgtcctgctcagcgacatcgcgtgcctgtacacc
gcgcccccgaacgagccgggagcccgccccatcacggaagtcgcgtggggggatgacctg
tccgacttcgagttcggggcgggcgtcgtcaacggcgtcggcaccgggggcgcggcgacc
aaggcctcggctgcgaagctcgcgtccgcggccggtgtcggcgtcctggtgaccagtgcc
gacctcgtcgccgacgctctcgcgggggagtccgtgggcacgtggttcgtcccaaatccg
gatgccgtcaccctgtcgaccggccccgtcggcgccgtcagcgcgacggtagactga

DBGET integrated database retrieval system