KEGG   Microbacterium testaceum: MTES_3504Help
Entry
MTES_3504         CDS       T01423                                 

Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mts  Microbacterium testaceum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MTES_3504
Enzymes [BR:mts01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MTES_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3790942..3791562
Genome map
AA seq 206 aa AA seqDB search
MISSLHGTAAHVAEDSLVIVVGGVGFSVAVTSQFARTVHVGDDVHVHTNLIVREDALSLY
GFESREELTVFTQLISVTGVGPKSALGVLSSLTVPQIAQAVTDDDDAPFRRVSGIGPKTA
KLIVVQLAGKLAVVPAAAPAAVAGHGQVPLQVTQALVGLGWTERTAAEAVASVAENASES
DRASVQALLRLTLALLGPARKETVGG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatctcttcgctccacgggacggcggctcacgtcgccgaagactctctggtcatcgtg
gtcgggggtgtcggcttctcggtggcggtcacctcgcagttcgcgcggacggtgcacgtg
ggcgacgacgtgcacgtgcacacgaacctcatcgttcgcgaagacgccctctcgctctac
ggcttcgagagccgcgaagaactcaccgtgttcacgcagctcatcagcgtcacgggcgtc
ggtccgaagtcggcgctgggcgtgctgtcgtcgctgaccgtgccgcagatcgcccaggcg
gtgaccgatgacgacgatgccccgttccgcagggtgtccggcatcggccccaagaccgcg
aagctcatcgtcgtgcagctggcgggcaagctcgccgtcgtccccgccgcagctcccgca
gccgtcgccggccacggacaggtgccgttgcaggtgacgcaggcgctcgtgggtctcggc
tggaccgagcgcacggcggccgaggccgtggcatccgtggccgagaacgcctcggagagc
gaccgcgcctcggtccaggcactgctgcgcctcacgctcgcgctgctggggcctgcgcgc
aaggagaccgtgggtggctga

DBGET integrated database retrieval system