KEGG   Microbacterium testaceum: MTES_3542Help
Entry
MTES_3542         CDS       T01423                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mts  Microbacterium testaceum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MTES_3542 (gmk)
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MTES_3542 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3835573..3836496
Genome map
AA seq 307 aa AA seqDB search
MVDSRRPPEVDRAAASRRAVAARRERAALKRDVSTRVISPQELLRRALADPSSAAGAMRV
TEFLTAIPAIGESKRDRILDALGISPVKRLGGLGSRQRDALRDYLDSRWPEPGPRAGRSR
LIVLAGPTAVGKGTVAAYIKENHPEIHLSVSATTRAPRPGEVEGEHYYFVDDAEFDRLVA
TGALLEWATVHNRHRYGTPREPIERVLATGGTALLEIDLQGARQVRAAEPSATLVFLLPP
SWDELVQRLVGRGTEDAEERARRLRTARTELAAQNEFDYRVVNDYVASAAAEVVALAARR
PGDPGSR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggttgattcccgccgtccgcccgaggtcgatcgcgccgcggcatcgcgacgcgccgtc
gctgcgcgccgcgagcgggccgcgctcaagcgcgatgtctccacgcgcgtcatcagcccg
caggagcttctgcgcagggccctcgccgacccgtcgtcggccgcgggcgccatgcgcgtg
accgagttcctcacggcgatccccgcgatcggagagagcaagcgcgatcggatcctcgac
gccctcggcatctcgccggtcaagcgactcggcgggctcggctcgcgccagcgcgacgca
ctccgcgactacctcgacagccgatggcccgaacccggcccccgtgccgggcggagccgc
ctgatcgtgctcgccggtcccaccgcggtgggcaaggggacggtcgccgcgtacatcaag
gagaaccaccccgagatccacctgtcggtgtcggcgacgacccgtgctccgcggcccgga
gaggtcgagggcgagcactactacttcgtcgacgacgcggagttcgatcgcctggtcgca
acgggtgcgctgctcgagtgggcgaccgtgcacaaccgtcatcgctacggcacaccgcgc
gagccgatcgagcgcgtgctggcgaccggcggtacggccctcctcgagatcgatctgcag
ggcgcccggcaggtgcgcgccgcggagccctcggcgaccctcgtgttcctcctcccgccg
agctgggacgagctcgtccagcgtctggtcggacgagggaccgaggatgccgaggagcgg
gcgcgccgcctgcgcaccgcccgcaccgagctggcggcccagaacgagttcgactaccgc
gtcgtgaacgactacgtcgcctcggccgcggccgaggtcgtcgccctcgccgcacggcgg
ccgggagaccccggaagccgctga

DBGET integrated database retrieval system