KEGG   Microbacterium testaceum: MTES_3555Help
Entry
MTES_3555         CDS       T01423                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mts  Microbacterium testaceum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_3555 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTES_3555 (trpC)
Enzymes [BR:mts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MTES_3555 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3846861..3847637
Genome map
AA seq 258 aa AA seqDB search
MLADLTAGAVEDAEKRAETRPLAEVERDALAQTPPRDALAMLAPADRVKIIAEVKRASPS
RGDLASIPDPARQARLYEEGGASAISVLTEGRKFKGSLADLEAVRAAVSVPVLRKDFIAT
PYQVLEARASAADLVLLIVAALDQKTLTELYGLVTDLGMTALVETHSADELERATDLGAK
LIGVNARNLSTFELDRDLFGSLADRFPADAVKIAESAVLAPADVAHYRAAGADVVLVGEA
LVTGDPVATLRAFLQETS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccgatctcacggccggggcggtggaagacgcagagaagcgcgccgagacgcgt
cctctcgcagaggtggagcgcgacgccctcgcgcagacgcccccgcgggacgccctcgcg
atgctcgcgcccgccgaccgggtcaagatcatcgccgaggtcaagcgcgcgagcccgtcc
cgcggggacctcgcgtcgatccccgatcccgcccgccaggcccgcctgtacgaagagggt
ggcgcgtccgcgatctcggtgctcaccgagggccgcaagttcaagggcagcctcgcagac
ctcgaggccgtccgcgcggccgtgagcgtccccgtgctgcgcaaggacttcatcgccacg
ccctatcaggtgctcgaagcccgcgcctccgcagccgacctcgtgctgctcatcgtcgcc
gctctcgaccagaagaccctcaccgagctctacggcctcgtgaccgacctcggcatgacg
gccctcgtcgagacgcactccgccgacgagctcgaacgcgccaccgacctcggcgcgaag
ctcatcggcgtcaacgcccgcaacctctcgaccttcgagctcgaccgcgacctgttcggc
tcgctcgccgaccgattcccggccgacgccgtcaagatcgccgagtccgcggtgctcgct
ccggccgatgtggcccactaccgcgccgcgggcgccgatgtcgtgctcgtgggcgaagcc
ctcgtcaccggcgatcccgtcgccacgctccgcgcgttcctccaggagacgtcatga

DBGET integrated database retrieval system