KEGG   Microbacterium testaceum: MTES_3556Help
Entry
MTES_3556         CDS       T01423                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mts  Microbacterium testaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_3556 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_3556 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTES_3556 (trpB)
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTES_3556 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3847634..3848962
Genome map
AA seq 442 aa AA seqDB search
MTTSLRDQKGPFFGDFGGRYMPESLIAAIDELTAVYESAMADPAFHAELRALLHDYAGRP
SALTEVPRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRLGKTRVIAETGAGQH
GVATATAAALFGLDCVVYMGEVDTERQALNVARMRLLGAEVVPVTTGSRTLKDAINEAYR
DWVASVETTNYIFGTAAGPHPFPAMVRDFQKIIGEETRAEFLERLGRLPDAVFACVGGGS
NAIGMFDAFLDDEGVALYGVEAAGDGVDTPKHAASIERGRPGVLHGARTYVLQDEDGQTT
ESHSISAGLDYPGVGPEHAWLADIGRAQYIPATDDEAMQALRLLSRTEGIIPAIESAHAL
AGALRIGRELGPDAVIAINLSGRGDKDMDTAARYFDLYDAEHAPEEPGPAQTKAAATVAS
ADGSPLDVTPAPDAASGAGVEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcctgcgcgaccagaaggggccgttcttcggcgacttcggcggccggtac
atgcccgagtcgctcatcgccgcgatcgacgaactgaccgcggtctacgaatcggcgatg
gccgatcccgcgttccacgccgagctgcgagccctgctgcacgactacgccggacgcccg
tccgctctcaccgaggtcccgcgcttcgccgagcacgcgggaggtgcgcgcgtcttcctc
aagcgcgaagacctcaaccacaccggctcgcacaagatcaacaacgtgctcggccaggcg
ctgctcaccaagcgtctgggcaagacccgtgtgatcgccgagaccggagccggccagcac
ggcgtcgccaccgcgacggccgcggccctcttcggactcgactgcgtcgtctacatgggc
gaggtcgacaccgagcgtcaggcgctcaacgtcgcccgcatgcgcctcctcggcgccgag
gtcgtccccgtcacgaccggctcgcgcacgctgaaagacgcgatcaacgaggcctaccgc
gactgggtcgcctcggtcgagacgaccaactacatcttcggcacggccgcaggcccgcac
ccgttcccggcgatggtccgcgacttccagaagatcatcggcgaagagacccgcgccgag
ttcctcgagcgcctcggccgtctccccgacgccgtcttcgcgtgcgtcggcggcggttcg
aacgcgatcggcatgttcgacgcgttcctcgacgacgagggcgtcgccctctacggcgtc
gaggcggcgggtgacggcgtcgacacgccgaagcacgcggcatccatcgaacgaggtcgt
cccggcgtcctgcacggtgcccgcacctacgtcctgcaggacgaggacggccagaccacc
gagtcgcactcgatctccgcgggcctcgactacccgggcgtcgggcccgagcacgcgtgg
ctggccgacatcggccgcgcccagtacatccccgcgaccgacgacgaggccatgcaggcc
ctccgcctcctctcgcgcaccgagggcatcatcccggcgatcgagtcggcccacgccctg
gccggagccctgcgcatcggtcgagagctgggtccggatgccgtcatcgcgatcaacctc
tccggtcggggcgacaaagacatggacaccgccgcccgctacttcgacctgtacgacgcg
gaacacgcgcccgaagagcccggtcccgcgcagacgaaggccgccgcgaccgtcgcgtcg
gcggacggctcgccgctcgacgtgacgccggccccggatgccgcgagcggcgcgggggtc
gaactgtga

DBGET integrated database retrieval system