KEGG   Microbacterium testaceum: MTES_3557Help
Entry
MTES_3557         CDS       T01423                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mts  Microbacterium testaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mts01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mts00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mts00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3848959..3849750
Genome map
AA seq 263 aa AA seqDB search
MTSRVSAAIEAAHAEGRGAFVAYLPAGFPDVATSIEAIVALAEAGADVIELGPPYSDPVM
DGLVIQEATQTALANGFRMRDLFTIIREVTARTDVPILVMTYWNLVEQYGVDRYADELVA
AGGAGLITPDITPDAASAWIATSERTGLDRVFLAAPTSTDERLAMIVGASTGFVYTVSTM
GITGERDQLDAAARRLVERLRAHGAAHACVGIGISNAAQVAGVVEYADGAIVGTALVKAL
RDGGVEGLSTLARELSAGTARRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgcgcgtctcggcagcgatcgaggccgcccacgccgagggccgtggcgcgttc
gtcgcgtatctgcccgccggcttccccgacgtcgccaccagcatcgaagcgatcgtcgcg
ctggccgaggccggcgccgacgtgatcgagctcggacctccctacagcgatccggtcatg
gacggcctggtcatccaggaggcgacgcagaccgcgctcgccaacgggttccgcatgcgc
gacctcttcacgatcatccgcgaggtcacggcgcgcaccgacgtgcccatcctcgtcatg
acgtactggaacctcgtcgagcagtacggcgtcgaccgctacgccgacgagctcgtggcg
gccgggggagcggggctcatcacgcccgacatcacccccgacgccgcgtcggcgtggatc
gcgacgagcgaacgaaccggtctcgaccgggtcttcctcgccgccccgacctcgaccgac
gagcgtctcgcgatgatcgtgggcgcgtccacgggcttcgtgtacaccgtctcgacgatg
ggcatcacgggggagcgggaccaactggatgccgctgcccgccgtctcgtcgaacggctg
cgcgcgcacggcgccgcccacgcgtgcgtcggcatcgggatctccaacgccgcccaggtg
gccggggtcgtcgagtacgccgacggcgcgatcgtcgggaccgcgctggtgaaggctctg
cgggacggcggcgtcgagggtctgtccaccctcgcgcgggagctgtccgcgggcaccgcg
cggcgcgcctag

DBGET integrated database retrieval system