KEGG   Microbacterium testaceum: MTES_3557Help
Entry
MTES_3557         CDS       T01423                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mts  Microbacterium testaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_3557 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_3557 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTES_3557 (trpA)
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTES_3557 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3848959..3849750
Genome map
AA seq 263 aa AA seqDB search
MTSRVSAAIEAAHAEGRGAFVAYLPAGFPDVATSIEAIVALAEAGADVIELGPPYSDPVM
DGLVIQEATQTALANGFRMRDLFTIIREVTARTDVPILVMTYWNLVEQYGVDRYADELVA
AGGAGLITPDITPDAASAWIATSERTGLDRVFLAAPTSTDERLAMIVGASTGFVYTVSTM
GITGERDQLDAAARRLVERLRAHGAAHACVGIGISNAAQVAGVVEYADGAIVGTALVKAL
RDGGVEGLSTLARELSAGTARRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgcgcgtctcggcagcgatcgaggccgcccacgccgagggccgtggcgcgttc
gtcgcgtatctgcccgccggcttccccgacgtcgccaccagcatcgaagcgatcgtcgcg
ctggccgaggccggcgccgacgtgatcgagctcggacctccctacagcgatccggtcatg
gacggcctggtcatccaggaggcgacgcagaccgcgctcgccaacgggttccgcatgcgc
gacctcttcacgatcatccgcgaggtcacggcgcgcaccgacgtgcccatcctcgtcatg
acgtactggaacctcgtcgagcagtacggcgtcgaccgctacgccgacgagctcgtggcg
gccgggggagcggggctcatcacgcccgacatcacccccgacgccgcgtcggcgtggatc
gcgacgagcgaacgaaccggtctcgaccgggtcttcctcgccgccccgacctcgaccgac
gagcgtctcgcgatgatcgtgggcgcgtccacgggcttcgtgtacaccgtctcgacgatg
ggcatcacgggggagcgggaccaactggatgccgctgcccgccgtctcgtcgaacggctg
cgcgcgcacggcgccgcccacgcgtgcgtcggcatcgggatctccaacgccgcccaggtg
gccggggtcgtcgagtacgccgacggcgcgatcgtcgggaccgcgctggtgaaggctctg
cgggacggcggcgtcgagggtctgtccaccctcgcgcgggagctgtccgcgggcaccgcg
cggcgcgcctag

DBGET integrated database retrieval system