KEGG   Microbacterium testaceum: MTES_3557Help
Entry
MTES_3557         CDS       T01423                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mts  Microbacterium testaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTES_3557 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTES_3557 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTES_3557 (trpA)
Enzymes [BR:mts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTES_3557 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3848959..3849750
Genome map
AA seq 263 aa AA seqDB search
MTSRVSAAIEAAHAEGRGAFVAYLPAGFPDVATSIEAIVALAEAGADVIELGPPYSDPVM
DGLVIQEATQTALANGFRMRDLFTIIREVTARTDVPILVMTYWNLVEQYGVDRYADELVA
AGGAGLITPDITPDAASAWIATSERTGLDRVFLAAPTSTDERLAMIVGASTGFVYTVSTM
GITGERDQLDAAARRLVERLRAHGAAHACVGIGISNAAQVAGVVEYADGAIVGTALVKAL
RDGGVEGLSTLARELSAGTARRA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgcgcgtctcggcagcgatcgaggccgcccacgccgagggccgtggcgcgttc
gtcgcgtatctgcccgccggcttccccgacgtcgccaccagcatcgaagcgatcgtcgcg
ctggccgaggccggcgccgacgtgatcgagctcggacctccctacagcgatccggtcatg
gacggcctggtcatccaggaggcgacgcagaccgcgctcgccaacgggttccgcatgcgc
gacctcttcacgatcatccgcgaggtcacggcgcgcaccgacgtgcccatcctcgtcatg
acgtactggaacctcgtcgagcagtacggcgtcgaccgctacgccgacgagctcgtggcg
gccgggggagcggggctcatcacgcccgacatcacccccgacgccgcgtcggcgtggatc
gcgacgagcgaacgaaccggtctcgaccgggtcttcctcgccgccccgacctcgaccgac
gagcgtctcgcgatgatcgtgggcgcgtccacgggcttcgtgtacaccgtctcgacgatg
ggcatcacgggggagcgggaccaactggatgccgctgcccgccgtctcgtcgaacggctg
cgcgcgcacggcgccgcccacgcgtgcgtcggcatcgggatctccaacgccgcccaggtg
gccggggtcgtcgagtacgccgacggcgcgatcgtcgggaccgcgctggtgaaggctctg
cgggacggcggcgtcgagggtctgtccaccctcgcgcgggagctgtccgcgggcaccgcg
cggcgcgcctag

DBGET integrated database retrieval system