KEGG   Microbacterium testaceum: MTES_3659Help
Entry
MTES_3659         CDS       T01423                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTES_3659 (tpiA)
   01230 Biosynthesis of amino acids
    MTES_3659 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_3659 (tpiA)
   00051 Fructose and mannose metabolism
    MTES_3659 (tpiA)
   00562 Inositol phosphate metabolism
    MTES_3659 (tpiA)
Enzymes [BR:mts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTES_3659 (tpiA)
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTES_3659 (tpiA)
  Exosomal proteins of bladder cancer cells
   MTES_3659 (tpiA)
  Exosomal proteins of melanoma cells
   MTES_3659 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3960961..3961749)
Genome map
AA seq 262 aa AA seqDB search
MGVTRTPLIAGNWKMNLDHLQAVAFVQKLHWTLKEAKHENGSVEVAVFPPFTDLRTVQTL
LDADKIEFALGGQDLSAHDSGAYTGEISGQFLAKLNARYVIIGHSERRQFHNETDEVVAA
KTQAALRHGLVPVICVGETSEDLEKFGASAVPVGQLEVALEGVASAAEIVVAYEPVWAIG
SGQAATPEQAQEVCAKLRAVVAEKLGADAAARTRVLYGGSVKANNIAAFMREPDVDGALV
GGASLVVDEFAAIIRYQKHVGV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgaccagaacccccctcatcgccggcaactggaagatgaacctcgaccacctg
caggcggtcgcgttcgtccagaagctgcactggacgttgaaggaagcgaagcacgagaac
ggcagtgtcgaggtcgcggtcttcccgccgttcaccgacctgcgcaccgttcagacgctc
ctcgacgcggacaagatcgagttcgcgctcggcggccaggacctgtccgcccacgactcc
ggtgcgtacaccggcgagatctcggggcagttcctcgcgaagctcaacgcgcgctacgtg
atcatcggtcactccgagcgtcgccagttccacaacgagaccgacgaggtcgtcgcggcg
aagacccaggcggccctgcgccatggtctcgtcccggtgatctgcgtcggcgagacctcg
gaagacctcgagaagttcggcgccagcgccgtgcccgtgggtcagctcgaggtcgccctc
gagggtgtggcatccgcggctgagatcgtcgtcgcttacgagccggtctgggcgatcggt
tccgggcaggcggcgacccccgagcaggctcaggaggtctgcgcgaagcttcgcgcggtc
gtcgccgagaagctcggcgccgacgcagccgcgcgcacgcgcgtcctgtacggcggttcg
gtcaaggccaacaacatcgccgcgttcatgcgcgagcccgatgtggacggtgccctggtg
ggtggcgcgagcctcgtcgtcgacgagttcgccgcgatcatccgctaccagaagcacgtc
ggggtctga

DBGET integrated database retrieval system