KEGG   Microbacterium testaceum: MTES_3659Help
Entry
MTES_3659         CDS       T01423                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts00010  Glycolysis / Gluconeogenesis
mts00051  Fructose and mannose metabolism
mts00562  Inositol phosphate metabolism
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
mts01120  Microbial metabolism in diverse environments
mts01130  Biosynthesis of antibiotics
mts01200  Carbon metabolism
mts01230  Biosynthesis of amino acids
Module
mts_M00002  Glycolysis, core module involving three-carbon compounds
mts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTES_3659 (tpiA)
   00051 Fructose and mannose metabolism
    MTES_3659 (tpiA)
   00562 Inositol phosphate metabolism
    MTES_3659 (tpiA)
Enzymes [BR:mts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTES_3659 (tpiA)
Exosome [BR:mts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTES_3659 (tpiA)
  Exosomal proteins of bladder cancer cells
   MTES_3659 (tpiA)
  Exosomal proteins of melanoma cells
   MTES_3659 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAJ76623
UniProt: E8NGW4
Position
complement(3960961..3961749)
Genome map
AA seq 262 aa AA seqDB search
MGVTRTPLIAGNWKMNLDHLQAVAFVQKLHWTLKEAKHENGSVEVAVFPPFTDLRTVQTL
LDADKIEFALGGQDLSAHDSGAYTGEISGQFLAKLNARYVIIGHSERRQFHNETDEVVAA
KTQAALRHGLVPVICVGETSEDLEKFGASAVPVGQLEVALEGVASAAEIVVAYEPVWAIG
SGQAATPEQAQEVCAKLRAVVAEKLGADAAARTRVLYGGSVKANNIAAFMREPDVDGALV
GGASLVVDEFAAIIRYQKHVGV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgaccagaacccccctcatcgccggcaactggaagatgaacctcgaccacctg
caggcggtcgcgttcgtccagaagctgcactggacgttgaaggaagcgaagcacgagaac
ggcagtgtcgaggtcgcggtcttcccgccgttcaccgacctgcgcaccgttcagacgctc
ctcgacgcggacaagatcgagttcgcgctcggcggccaggacctgtccgcccacgactcc
ggtgcgtacaccggcgagatctcggggcagttcctcgcgaagctcaacgcgcgctacgtg
atcatcggtcactccgagcgtcgccagttccacaacgagaccgacgaggtcgtcgcggcg
aagacccaggcggccctgcgccatggtctcgtcccggtgatctgcgtcggcgagacctcg
gaagacctcgagaagttcggcgccagcgccgtgcccgtgggtcagctcgaggtcgccctc
gagggtgtggcatccgcggctgagatcgtcgtcgcttacgagccggtctgggcgatcggt
tccgggcaggcggcgacccccgagcaggctcaggaggtctgcgcgaagcttcgcgcggtc
gtcgccgagaagctcggcgccgacgcagccgcgcgcacgcgcgtcctgtacggcggttcg
gtcaaggccaacaacatcgccgcgttcatgcgcgagcccgatgtggacggtgccctggtg
ggtggcgcgagcctcgtcgtcgacgagttcgccgcgatcatccgctaccagaagcacgtc
ggggtctga

DBGET integrated database retrieval system