KEGG   Marivirga tractuosa: Ftrac_0031Help
Entry
Ftrac_0031        CDS       T01365                                 

Definition
signal transduction histidine kinase with cheb and cher activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mtt  Marivirga tractuosa
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ftrac_0031
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ftrac_0031
Enzymes [BR:mtt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Ftrac_0031
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ftrac_0031
Two-component system [BR:mtt02022]
 CheA family
  CheA-CheYBV
   Ftrac_0031
Bacterial motility proteins [BR:mtt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ftrac_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(34175..38197)
Genome map
AA seq 1340 aa AA seqDB search
MVTNRTPIIGIGASAGGLEPLEVFFNYANHIAGYAYVVIQHLAPNHKSLMDELLARHTNL
PIKVIEDGMAIDPNTIYLNPPKKFVTLSGNKLKLSDKEDKKLSFPITTFFQSLAEHNQEL
SAAIVLSGTGSDGSEGIKFIKEKGGIVLVQDPESSKFDGMPKNAIHTGSVDKVCAVEDLP
KELDIFFNSNKKLTLLDFQTDENSKQIKNILKEVENQTQIDFSGYKFSTMYRRTVRRMGI
QGFSNLDKYLDYLKKNKSEGALLAKELLIGVTRFFRDSDTFDAIRDRLIPELIRQASETK
NIRVWVPACSSGEEAYSIAILIKDYLRKNNLQYDVKIFATDLDVEAIKAASNPFFPENIA
NEIEPNILGAYFIHQKEGYKIANEIRDMIVFTVHNIIQDPPFSKIDLVSCRNFLIYLNPN
IQKQLFSLFQFTLKSNGFLVLGSSESVGEKDTAFQEFDKKHKIFQNKKNQKVLKPMDQGA
NKKPIRMKMTPSTDQNQISSANSKFSISPKKMLENIRDFLIQEYVPDAVIFNQNFDLVHT
TGRTNQWLKLPLGVVSINILRMLPENLSLTFEVAANKIIQEDKEVSLKNAELTPEMEKIY
DTKFLNIYFKKIESDDGSVLIIALFEGNKSIQKKGKTSPINLDLASKEKIELLERELKVN
KENLQTTIEELESSNEELQASNEELQSSNEELESVNEELHTVNAEFQEKVEELTASNNDL
NNLIYSTNIAILFLDEELNIRKFTPALKDILNLMPHDEGRHISHFRSRFQIENFTDKIEG
VHRDLQPFETTIQDPNDRKFMMRVSPFRTNKNEIKGVVISFVEITSYSQANNSIQLNENA
LNQINQDFETQIELFKLIINQSSEMISLLDLNGKIEYISPASKEILGVTPEDLLTINPNK
FIKDKDHRNLWKSTFNKIKKGENTATIQIELKTGKKESKWLETRFAAVNNEGGELFKILA
ISKDVSRRIYFEEEIQKLSLIAKQTKYAVIITDLEGKINYVNESFLKLTGYKESYVLGRK
PGDFLQGKETDPKTVKIMSDAIKERKGFEVDIINYTDKGHKYWTNIQCELLHDRFRKPIG
FFSIQAEISREKEFENQIESLNQILRSRNNKLTDLNKSLEEFAYVASHDLKEPARNIKSI
LELILKKSKGELNEKLENYMRMAAGAGDKMNQMINSLLEYSRSGVLNEELKTINLNDMTE
EVKFSLQKLIKENNAIISVNDNIGDFKAYPILFGRLLQNLIQNAIKYRSEKKPEITLKAS
EDEFSYIFSVADNGIGISQRDFDRVFKIFQKVHQEDNESHGIGLAVCKKIVETHLGEITV
ESQEGYGTTIHFSISKKLDS
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaaaccgaacaccaatcataggcatcggtgcttctgcgggaggcctagagccc
ttggaagtcttttttaattatgctaatcatattgcaggatatgcttatgtagtcattcag
catttagcccccaaccataaaagcttgatggatgagttgttggcaaggcatactaattta
cccatcaaagttattgaagatgggatggctattgatcccaataccatctaccttaatcca
cctaaaaagtttgtcactctttcagggaataaattaaaattaagcgataaggaagataaa
aagttaagctttcccattactacctttttccaatctttagctgagcataaccaagaactc
tcagcagccattgttttatcaggaactggcagtgatggctccgaaggaattaaatttatt
aaagaaaaaggaggaattgtattagtgcaagacccggaatcatcaaaatttgatgggatg
cccaaaaatgccatccataccggttctgttgataaagtatgtgccgttgaggacttacct
aaagaacttgatatattctttaatagcaataaaaagttaacattacttgattttcagaca
gatgaaaacagcaagcaaatcaagaatatcctaaaagaagttgaaaatcaaacccaaatt
gatttctctggatacaaattctccactatgtacaggagaacggtaagaagaatgggtata
caaggcttctccaatttggataaatatttagattatctcaaaaagaataaatctgaaggg
gctttattggcaaaagaattacttataggagttacccgttttttcagagattccgatact
tttgatgccatcagagatagactcattccagaattaattagacaagcatcagaaaccaaa
aatattagagtatgggttcctgcttgttctagtggggaagaagcctactctatagccatt
ttaataaaagattatttacggaaaaataatcttcaatatgatgtaaaaatctttgcaacg
gacttggatgtcgaggccataaaagcggctagcaatcccttttttccggaaaatattgcg
aatgaaatagaacccaatattttaggagcatattttatccatcaaaaagaaggctacaag
attgcgaatgaaatccgtgatatgattgtctttacggttcacaatatcattcaggatcct
ccatttagtaaaattgatttagtcagctgccggaattttttaatttatctgaatcctaat
attcaaaaacagcttttttctctctttcaattcaccttgaaatcaaatggattcctagta
ttaggctcaagtgaatcagttggagagaaagatactgcatttcaagagttcgataaaaaa
cataaaatatttcaaaataaaaagaatcaaaaggtcttaaaaccaatggatcaaggagcc
aataagaaacccattaggatgaaaatgactccttcaacagaccaaaatcaaatcagctcg
gcaaacagtaaattttcaatctctcctaaaaaaatgttggaaaacatcagagacttttta
attcaagaatatgtccctgatgcagtcatatttaatcagaattttgatttggttcatacc
acaggaagaactaatcaatggctcaaattacctttaggcgtagtcagcatcaatatcctt
agaatgttgcctgaaaatttaagtttaacttttgaggtcgctgccaataaaattattcaa
gaagacaaggaagtaagcttaaaaaatgcggagctcactccggaaatggaaaaaatatat
gacacaaaattcctcaatatttatttcaaaaaaatagaaagtgatgatgggtctgtattg
attattgcattgtttgaagggaataaaagcatacaaaagaaaggtaaaacctctcctatc
aacttagatttagcctccaaagaaaaaatcgagctactggaaagagaattaaaggtaaat
aaagaaaaccttcaaacaaccattgaagaacttgaatcaagcaacgaggaactacaagca
tccaatgaagaactgcaaagttcaaatgaagaattagagtcagtaaatgaggaattacat
actgtaaatgcagagtttcaagaaaaagtagaagaactgaccgcttccaataatgattta
aacaaccttatttacagcaccaatattgcgatactttttttagatgaagaactcaatatt
aggaagtttacccctgcacttaaagacatacttaatttgatgccacatgatgaaggtagg
catatcagtcattttaggtctcgctttcaaattgaaaatttcaccgataaaatagaggga
gttcacagagatttacagccttttgaaacgaccattcaggaccccaacgaccgtaagttt
atgatgagggtttctccctttagaacgaataaaaatgagattaaaggtgttgtaatatca
tttgtggaaatcacatcatattcccaagccaataattcaatacaacttaatgaaaatgct
ttaaatcaaattaatcaggatttcgaaacacaaattgagctattcaaattgattataaat
caatcaagtgaaatgattagtttgctcgatttgaacgggaaaatagagtatatttcacct
gcttcaaaagaaattttaggtgtgacccctgaagatttacttaccataaatcccaataaa
tttattaaagacaaagaccaccgaaacttatggaaaagcacatttaataaaataaagaaa
ggggaaaatacagctactatccaaattgaactcaaaacaggaaagaaggagtcgaaatgg
ttggaaactcgatttgcggccgttaataatgaaggtggtgaattatttaaaatactagct
attagtaaggacgttagtagaaggatttatttcgaggaagaaattcaaaaactatcatta
attgccaaacagactaaatatgcggtgatcattaccgatttagaaggcaaaattaattat
gtaaatgaatcatttcttaaattaacaggctataaggaatcgtatgtgttaggtagaaag
ccgggagattttttacaaggaaaggaaacagatcctaaaacggtaaaaatcatgagtgat
gccataaaagaaagaaaaggttttgaggtggatatcattaattatactgacaaaggacat
aagtattggactaatatccaatgtgaacttttacatgatagattcagaaaacctataggt
ttcttttccattcaagctgaaataagtcgtgaaaaagaatttgaaaatcaaattgagtca
ttgaaccaaatactaagatcccgaaataataagcttacagatttgaataaatccttagaa
gaatttgcttatgttgcctcacatgatctaaaggaaccagcccgaaatattaaaagcata
ttagaattaatattgaaaaaatctaaaggagagttgaatgaaaaattagagaattacatg
cgaatggcagcaggagcaggagataaaatgaaccagatgatcaactcattgttggagtat
tctaggtcaggagttttaaatgaggaattgaaaaccattaaccttaacgacatgaccgag
gaagtgaaattctcgcttcaaaaacttataaaagaaaacaatgccattattagcgtgaat
gataatattggtgatttcaaagcatatcctatcctattcggaagattattacaaaactta
atacaaaatgccattaaatatcggtcagaaaagaagcctgaaataaccctcaaagcctca
gaagatgaattcagttacattttttctgtagctgataatggcattggcatatctcagcgt
gattttgaccgagtatttaaaatttttcagaaggtacatcaagaagataatgagagccat
ggaattggactagccgtatgtaaaaaaattgtggaaactcatttaggtgaaatcacggtg
gaaagccaagaaggatatgggaccactatccattttagtattagtaaaaaacttgattct
taa

DBGET integrated database retrieval system