KEGG   Marivirga tractuosa: Ftrac_0033Help
Entry
Ftrac_0033        CDS       T01365                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mtt  Marivirga tractuosa
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ftrac_0033
   00670 One carbon pool by folate
    Ftrac_0033
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Ftrac_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(40891..41394)
Genome map
AA seq 167 aa AA seqDB search
MKISMIVAKANDNAIGKDNDMIWHLPDDLKYFKDKTRNHHILMGRKNFDSLGEKYQPLPK
RVNIVITRNKDWEHDGVKVFHDIKDGIEFAKSNNEEELFIIGGGQIYKQGLKYADRMYIT
EVDAEFPDAEAYFPEFDKSQWKELSREHHPRDDRHAFEFDYVVYDRK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatccatgatagtggcaaaggctaatgataatgccataggaaaagacaatgat
atgatttggcacctgccagatgatttaaaatatttcaaagacaaaactagaaaccatcat
atcttgatggggagaaaaaactttgattctctgggcgagaaatatcagcctttacccaaa
agagtgaacatcgtcatcacccgaaataaagattgggagcatgatggcgtaaaagtattt
catgacattaaagatggaattgaatttgccaaatctaataatgaagaggagttgtttatc
ataggaggtggtcaaatctataagcaaggtttaaaatatgcggataggatgtatatcaca
gaggttgatgcagaatttcccgatgcagaagcttattttcccgaatttgacaaatcacag
tggaaagaattaagtagagaacaccaccctagggatgataggcatgcttttgaatttgac
tatgtagtgtatgaccggaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system