KEGG   Marivirga tractuosa: Ftrac_0316Help
Entry
Ftrac_0316        CDS       T01365                                 

Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mtt  Marivirga tractuosa
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mtt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(410089..410880)
Genome map
AA seq 263 aa AA seqDB search
MLTFPNAKINLGLNITAKREDGYHDIESCFYPIPLKDALEIIPSEKLSFETTGLKIPGNS
NDNLVFKAYKLLKADFKLTPVDIILHKNIPMGAGMGGGSANGAFMLTLLNDYFELNISTQ
KLQQYALKLGSDCPFFIENKPKLISGRGEISENTELDLSGYYLALVYPNIHISTAEAYSA
VKPKKPAVSVKEIIETYPIEKWKDLLNNDFEKGIFEKYPQLNEIKNKFYSEGAIYSSMTG
SGSTIFGIFKESSEKNYDTILAL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctcacattccccaatgctaaaatcaatttagggcttaatatcactgccaagcgtgaa
gatggttatcatgatattgaatcctgtttctatcctatccctctaaaagatgcattggag
attattccttcagaaaaattgagctttgaaactactggcttaaaaataccggggaattct
aatgataatttagttttcaaagcttacaaattattaaaagcggatttcaaattgactcca
gtagatataatcctacataaaaacatccctatgggagctggaatgggcggtggttctgcc
aatggagcttttatgttgaccttacttaatgattattttgaactcaatatttcaacccaa
aaacttcagcaatacgcattgaaacttggaagtgactgtccttttttcattgaaaacaaa
cctaaattaatcagtggaagaggtgaaatttcagaaaatactgagcttgatttatcaggc
tattaccttgcattggtttaccctaatattcacatcagtacagcagaagcatatagtgca
gtaaaacctaaaaagccagcagtttcagttaaagaaatcatagaaacctatccgattgaa
aaatggaaagatttattaaataatgattttgaaaaaggcatttttgagaagtatcctcaa
ctgaatgaaattaagaataagttttatagtgagggagctatttattcaagcatgaccggc
agtggatctactatttttgggatatttaaagagagttctgaaaaaaattatgatacaata
ttagcgctatag

DBGET integrated database retrieval system